KEGG   Desulfotomaculum acetoxidans: Dtox_2318Help
Entry
Dtox_2318         CDS       T00986                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
dae00230  Purine metabolism
dae01100  Metabolic pathways
Module
dae_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dtox_2318
Enzymes [BR:dae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dtox_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin ADK AAA_33 Cytidylate_kin AAA_18 Thymidylate_kin ABC_tran AAA_17 AAA_22 Rad17 MMR_HSR1 RsgA_GTPase AAA_16 cobW AAA_29 AAA
Motif
Other DBs
NCBI-ProteinID: ACV63131
UniProt: C8W076
Position
complement(2487443..2488039)
Genome map
AA seq 198 aa AA seqDB search
MVLKGLLLVISGPSGAGKGTVCQALLKKKQNMYLSVSATTRQPRSGEIQGVNYWFKTKEE
FEHLLVEDQFLEYARVYDNYYGTPRLEVEKALETGKDVILEIDIQGALQVKEKMPNSVLV
FIVPPSLTELKTRLVNRGTDSAAEIEKRLKCVAEEIKYISSYGYIVINNTVNEAVGKVEA
ILIAEKCRPYYYDFAKYL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggttctgaagggattactgttggttatttccggcccctctggagccggtaaaggaact
gtttgccaggcacttttaaagaaaaaacaaaatatgtatttatctgtctcagctaccacc
agacagccgagatccggtgaaatacagggagtaaattactggtttaaaactaaagaagaa
tttgaacatttgttggttgaagatcaatttttggagtatgccagagtttacgacaactac
tacggcacaccgcgtctggaagtagagaaagctttggaaacaggcaaggatgttatttta
gagattgatattcaaggcgctttgcaggtaaaagaaaaaatgcctaactcagtactggtt
tttattgttccaccttcactgactgaattaaagaccagattagtaaacaggggcacagat
tctgcggctgaaatagaaaagcggctgaaatgtgtagctgaggaaattaagtatatatcc
agctatggttatatagtcattaataatactgtaaatgaagcagtcggtaaagttgaagcc
atattaatcgctgaaaagtgccgaccctattattatgattttgctaaatacctttaa

DBGET integrated database retrieval system