KEGG   Desulfotomaculum acetoxidans: Dtox_3204Help
Entry
Dtox_3204         CDS       T00986                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
dae00900  Terpenoid backbone biosynthesis
dae01100  Metabolic pathways
dae01110  Biosynthesis of secondary metabolites
dae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dtox_3204
Enzymes [BR:dae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Dtox_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ACV63946
UniProt: C8W4R0
Position
complement(3405531..3406691)
Genome map
AA seq 386 aa AA seqDB search
MNKKIAVLGSTGSIGRQTLQIAESCPGQLEVVGLAAGRNWPLLVEQVKKFRPAVVAVAGE
TEAVQLRAGLGAEYKVEIYTGAEGLEVIASLSEVDTVVTAVTGTVGLSPTVAAIKAGKHI
ALANKETLVAAGELVMQLADSHGISILPVDSEHSAIWQCLNGEKRAALQKIILTASGGPF
REKSFGELAAVTVEMALAHPNWSMGKKITVDSATLMNKGLEVIEAHWLYDVAYESIQVVI
HPQSIIHSMVEFVDGSVIAQLGLPDMRLPIQYALSYPDRWESKLPRLDFKNQFGLTFEQP
DFERFPCLGLAFAAGRAGGTMPAVLNAANETAVAAFLEKRLSYQGIASLVDEVMNLHRVI
KHPDLETVLQVDIWARRQAARLIGKL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaattgctgttttgggaagtaccggttctattggcaggcaaactttgcaa
atagcggaaagctgtcccggtcagcttgaggtggttggtctggcggcaggtagaaactgg
ccgcttctggttgagcaggtgaaaaaatttcggccggcagttgtagctgtggcgggagaa
acagaagcggttcaattgagagccggtctgggcgctgaatataaggtggagatttataca
ggtgcagagggtttggaggttatcgcctcgttatctgaggttgatactgtggtcaccgcg
gtaacaggtactgttgggctgtccccgactgttgcagccattaaggccggcaagcatata
gctttggccaataaagagacactggtggcggccggggagttggtcatgcagttggctgat
agccacgggataagtattttgccggtggacagtgaacattcggctatctggcagtgtttg
aacggtgaaaagcgagctgctttgcaaaagataattttaactgcctcgggcggccctttt
cgggaaaagagcttcggagagctggcggcagtcacggtagaaatggctttagcccatcct
aactggtctatgggtaagaaaattactgttgattcggcgactttgatgaataaagggctg
gaggtgatagaggcccactggctgtatgatgttgcctatgagtctattcaggtggttatt
caccctcagagtattatacactctatggttgaatttgttgacggctcggttatagcccag
ttgggtttgcctgatatgaggttgcctattcagtatgctttatcctatcctgacaggtgg
gagtctaaattgccgcgcctggacttcaagaatcagtttgggttgacctttgagcagcct
gattttgagcgttttccctgtttgggcctggcttttgccgcaggccgggccggcggcact
atgccggccgtgctcaatgcagccaatgagactgcggttgccgcatttttggagaaacgc
ttatcctatcaaggcattgcttccctggtagatgaagttatgaatttacaccgggtaatc
aaacatcctgatcttgaaactgtattgcaggtagatatctgggcgcgtcgtcaggcagca
cgactgattggaaaactttag

DBGET integrated database retrieval system