KEGG   Desulfotomaculum acetoxidans: Dtox_3319Help
Entry
Dtox_3319         CDS       T00986                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
dae00071  Fatty acid degradation
dae00280  Valine, leucine and isoleucine degradation
dae00310  Lysine degradation
dae00362  Benzoate degradation
dae00380  Tryptophan metabolism
dae00620  Pyruvate metabolism
dae00630  Glyoxylate and dicarboxylate metabolism
dae00640  Propanoate metabolism
dae00650  Butanoate metabolism
dae00720  Carbon fixation pathways in prokaryotes
dae00900  Terpenoid backbone biosynthesis
dae01100  Metabolic pathways
dae01110  Biosynthesis of secondary metabolites
dae01120  Microbial metabolism in diverse environments
dae01130  Biosynthesis of antibiotics
dae01200  Carbon metabolism
dae01212  Fatty acid metabolism
dae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dtox_3319
   00630 Glyoxylate and dicarboxylate metabolism
    Dtox_3319
   00640 Propanoate metabolism
    Dtox_3319
   00650 Butanoate metabolism
    Dtox_3319
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dtox_3319
  Lipid metabolism
   00071 Fatty acid degradation
    Dtox_3319
   00072 Synthesis and degradation of ketone bodies
    Dtox_3319
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dtox_3319
   00310 Lysine degradation
    Dtox_3319
   00380 Tryptophan metabolism
    Dtox_3319
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dtox_3319
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dtox_3319
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dtox_3319
Enzymes [BR:dae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dtox_3319
Exosome [BR:dae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dtox_3319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACV64050
UniProt: C8W5Q0
Position
complement(3521453..3522634)
Genome map
AA seq 393 aa AA seqDB search
MAREVVIVAAKRTPIGDFLGSLKDVPAVDLGMTAAKAALEQAGVLPELVEDVTAGMVYKQ
GVKGNPARQIQLGLQIPVETCACTVEQLCASGMRAFEIAAQQIMLGKSEISLTVGLESMS
RVPYLMLSAREGMRMGDSKIYDALTHDALFDAFHNYHMGVTAENIAEKYSISREEQDQLA
VTSHERACQAIAAGKFKEEIVPVEVKGKKAVTVVEHDEHPRQGLNMENLAKLKPVFTKDG
TVTAGNASGINDGASAMVLMSAERARELGIKPLARLLATANVGVLPEIMGMGPAHAIPKV
LKYAGLTLDQIDYFEINEAFAAQFLGVNRELQLPMDKVNANGSGIAIGHPVGCTGSRILV
ALIYEMSRRQARYGCASLCVGGGPAMAAVIERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggccagagaagttgttattgtcgcagctaaaagaactccaatcggtgattttttggga
tctttaaaagacgtgcccgctgttgatttaggtatgacagccgctaaggctgccctggag
caagcaggagttttgccggagctggtagaggatgtgacagccggcatggtttacaagcag
ggggttaagggcaacccggcccggcaaatccaacttggcttgcagattcctgttgagact
tgtgcctgtacagtggaacagctttgcgcgtccggcatgagagcttttgaaattgctgct
caacaaataatgctgggcaaatctgagataagtttaacggttggcctggaaagcatgagc
agggttccctatttaatgttgagtgcccgtgaaggcatgcgtatgggagattccaaaatc
tatgatgcgctgacccatgatgcattgtttgatgcttttcataattaccatatgggggtt
accgctgaaaatatagctgaaaaatactctatttcacgtgaagagcaggatcaactggct
gtaaccagtcatgaacgggcctgtcaggccattgccgcaggtaaattcaaggaagaaata
gtgcctgtagaggttaagggtaaaaaggctgttacagtggttgagcatgatgaacatccc
cggcagggcctgaacatggaaaatctggctaaattaaagcctgtgttcacaaaggacggt
actgtcacagccggcaatgcttccggcataaatgacggtgcttccgctatggtgctgatg
tcggcggagagagcccgggagttgggaataaaaccgttggccaggctcctggctactgca
aatgtaggcgtgcttccggaaataatgggcatgggacctgcccatgccatacctaaggta
ttgaaatatgccggtttgacattggatcaaatagattattttgaaattaatgaggctttt
gccgcgcagtttctgggggtaaaccgcgaactgcaactgcctatggataaagtcaatgct
aacggttcgggtattgctatcgggcaccctgtaggctgtaccggcagcaggattttagtg
gcattgatatatgagatgagcaggagacaggccaggtacggttgtgcatccctgtgcgtg
ggtggcggtccggctatggccgctgtcattgaaaggctttaa

DBGET integrated database retrieval system