KEGG   Desulfotomaculum acetoxidans: Dtox_3566Help
Entry
Dtox_3566         CDS       T00986                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dtox_3566
Enzymes [BR:dae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Dtox_3566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3765898..3766761)
Genome map
AA seq 287 aa AA seqDB search
MNGLVERNTRFMGCSDSYEQSAVVITGVPMDFTVSFRPGSRFGPQEIRQVSFGLEEYSYY
LNRDLRDFTFFDYGDLILPYGNIKECLKRIGQVAEKLFSEGKFPLVLGGEHLISLPFIEK
AAAFYPGLALIHLDAHADLREDYMGEVYSHATVIRRAVEAVGGRNVYQFGIRSGDGSEFA
YARKETNFYPDEVIGPLKKILQQLGDRPVYVTMDIDVVDPAYAPGTGTAEPGGITSREAL
QVIHLLGQTRVIGFDLVEVSPPYDATQRTSLLAAKLVREIILSFGGK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcctagtcgaaagaaatacgcgtttcatgggatgttcggacagctatgagcaa
tcagcggtggtgataaccggtgtgccgatggactttacggtaagctttcggcctgggtcc
agatttggcccgcaggagatcaggcaagtatcttttggtctggaagaatatagttactat
ctgaatcgtgatctgcgggatttcaccttttttgactatggcgatttaatcttaccctat
ggcaatataaaagaatgcctgaaacgtattggccaggtagccgagaaactgttttctgag
ggtaaattccccctggtattaggcggtgagcacttaatcagccttccttttatagaaaaa
gccgccgccttttatcctggtctggcgttgattcatttggatgctcacgcggatttgagg
gaagattatatgggagaggtctattcacacgctactgtgataaggcgtgcagtcgaggca
gtgggcggcaggaatgtttaccagttcggtattcgctcgggtgacgggtctgagtttgct
tatgcccgtaaggaaacaaatttctaccctgatgaggtgattggtccccttaaaaaaatt
ttgcagcagttgggggataggcctgtatatgtaactatggatatagatgtggttgaccct
gcctatgctccaggcaccggcaccgctgagccgggtggaattacttcacgggaggcctta
caggtaattcatcttctggggcagaccagggtgattggttttgatttggtagaagtcagc
ccgccctatgacgctacccagcgtacttctttattggcggccaagttggtgcgggaaata
attttgagtttcggcggaaaataa

DBGET integrated database retrieval system