KEGG   Desulfotomaculum acetoxidans: Dtox_4112Help
Entry
Dtox_4112         CDS       T00986                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dtox_4112
   00052 Galactose metabolism
    Dtox_4112
   00500 Starch and sucrose metabolism
    Dtox_4112
   00520 Amino sugar and nucleotide sugar metabolism
    Dtox_4112
Enzymes [BR:dae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dtox_4112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4281488..4282357)
Genome map
AA seq 289 aa AA seqDB search
MLVKKAIIPAAGLGVRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEDILIITGSNK
RAIEDHFDKSHVLEMQLQLKGKTDLLKTVQDISNLAEIYYIRQKEPLGLGHAVYCARSFI
KNEPFAVLLGDDIVSSTKPCLKQLMELYEEVQAPVLGIKEVPLEDVDKYGILEAEPVRPQ
VYKVSDLVEKPEPHEAPSRLAVMGRYIINPGIFDILENTKPGAGGEIQLTDALRVQGQAE
GMYGLVFDGRRYDVGDKMGYLKATVEFALGRKDLKEVFSQYIRGIAENL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtaaaaaaagcaattatacctgcagccggtttgggagtgagatttcttcccgct
accaaggcgcagccaaaagaaatgctgccgattgttgataagccgactatccaatatatc
attgaggaggcagtagcctccggtattgaggatatattgattattaccggaagcaacaaa
agggctattgaggatcattttgacaaatcccatgttttggagatgcagctgcagctaaag
ggcaagactgatttgttaaaaacggttcaggacatcagcaacctggcggagatctattat
attcgccagaaggaaccgctgggtttagggcatgctgtatactgtgcccgcagttttatt
aaaaatgagccttttgccgtgctgctgggtgatgacattgtcagcagtacaaaaccctgt
ctcaagcagttgatggagttgtatgaagaagtgcaggcgccggtgctgggaataaaagaa
gtgccactggaagatgttgataagtacggtatcttagaggctgagccggtcaggccccaa
gtatataaagtcagtgatctggtggaaaaacctgagccccacgaggctccttcacgcttg
gccgttatgggcaggtatattattaacccgggcatttttgatattctggagaataccaaa
ccgggagccggaggagagattcaacttacagacgccttacgggtgcagggacaggcagag
ggcatgtacggattggtttttgacggccggagatatgatgtgggagataaaatgggatat
ctgaaagctacggtggaatttgctctgggcaggaaggatttaaaggaagtattttctcaa
tatattaggggtattgcagaaaatttatag

DBGET integrated database retrieval system