KEGG   Desulfotomaculum acetoxidans: Dtox_4133Help
Entry
Dtox_4133         CDS       T00986                                 

Definition
family 2 glycosyl transferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Metabolic pathways
Brite
Enzymes [BR:dae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     Dtox_4133
Glycosyltransferases [BR:dae01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   Dtox_4133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4301987..4302919)
Genome map
AA seq 310 aa AA seqDB search
MGLFISIVVPMYFEEKVVNECYMRLTSVLEQNKINYEIIFINDGSTDNTLQILETLAIKD
SRVKIINFSRNFGHQAAVTAGIENSFADAVVVIDADLQDPPELIPEMINLWENGYEVVYA
KRKKRKGENWFKLITAKYFYRILSQMTEVSIPIDTGDFRLIDKKVIEEFKKMPEKNRFIR
GMISWIGFKQIAIEYERDKRFAGDTKYPLKRMVKFALDGIISFSAKPLKLLGILGFSSVS
ISLVLLLYTITVKFLNNNDVISGWASLMTTIIFFGGVQLLSVSVLGEYVGRIYDESKNRP
LYIIDKKVNF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggggttattcatttcaatagtagtaccgatgtatttcgaagaaaaagtggtaaatgaa
tgttatatgcgtttaactagtgttttagaacaaaataaaattaactatgaaattattttt
attaatgatggtagtactgacaatacattgcaaatacttgaaactcttgctataaaggat
agtcgagttaaaataataaatttttcaagaaattttggacatcaagcggcagtcactgct
ggtattgaaaactcctttgccgatgctgttgtagttattgatgcagacttgcaggatccc
cctgagttaattccagaaatgataaatctttgggaaaatggttatgaagttgtttatgca
aaaagaaaaaaaagaaaaggtgaaaactggtttaaattaattactgcaaagtatttttat
aggattctttcacaaatgacagaagtaagtattcctatcgatactggtgattttagattg
atagataaaaaagtaatagaagagtttaaaaaaatgccagaaaaaaatcgatttattaga
gggatgattagctggattggttttaaacagatagccattgagtatgagagagacaagaga
tttgctggtgatacaaagtatccactaaaaagaatggttaaatttgctcttgatggaatt
atatcattttcggctaagccactaaaattactggggatattaggattttcttcggtatct
atatctttagtgctgttattatatactattacagttaagtttctaaataataatgatgta
ataagtgggtgggcatcattaatgactacaattattttttttgggggtgttcaacttctt
tccgttagcgtattaggtgaatatgttggtaggatatatgatgaaagcaagaatagacct
ttgtatataatagacaaaaaggttaacttttaa

DBGET integrated database retrieval system