KEGG   Desulfotomaculum acetoxidans: Dtox_4179Help
Entry
Dtox_4179         CDS       T00986                                 

Definition
protein tyrosine phosphatase
Orthology
K01104  
protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
dae  Desulfotomaculum acetoxidans
Brite
Enzymes [BR:dae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     Dtox_4179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4355784..4356254)
Genome map
AA seq 156 aa AA seqDB search
MSSKILFVCTGNTCRSSMAEALARKILSIKQSVPDIIVASAGVAAWPGGPASPQAVEALW
EYRIDLSSHRAKMVNWQEVDGADLILTMTASHRQILISRFPSAAGKIFTLGSYSGEEGDI
VDPFGQTVAVYRKCAASLWELLETALDKFCRQLEKE
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgaaaatactatttgtctgcaccggcaacacctgccgcagcagtatggctgaa
gcgctggccaggaaaatcttaagcattaaacaatctgttccggatattattgtagcttcc
gccggggtagccgcctggcccggtggccctgcttctccacaggcagttgaggccctgtgg
gaataccgtattgatctttcctcacaccgggcaaaaatggtgaactggcaggaagttgac
ggagcggatttaatattaaccatgactgcctcacaccgccaaatactcatctcacgtttt
ccttctgccgcgggaaaaatatttaccctgggttcctattcaggtgaggaaggggatata
gttgatcctttcggtcagacagtggctgtctatcgcaaatgtgccgcttcgttatgggaa
ttgcttgaaacggccctggacaagttctgccgtcagctggagaaagaataa

DBGET integrated database retrieval system