KEGG   Desulfovibrio africanus: Desaf_0005Help
Entry
Desaf_0005        CDS       T01662                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
daf  Desulfovibrio africanus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:daf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4522..5130)
Genome map
AA seq 202 aa AA seqDB search
MIGYIRGTLLEQTEKSCLVLTAGGVGYELHLPLPALARLPAEGQEVSFHTEQVVREDSQD
LYGFETSEERRLFHVLLSIPNLGPKKGLAILSQFHPDDLRQIVLHEDIAALTRVSGIGKK
TGQQILWELKYKLASADAPAVGRKPAAPGRSVLQDALAGLTNLGYSEEEARPVLHKLFEA
EPDLDVAQLLREALKAIAKARA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcggctacatccgcggcacacttctggagcagaccgaaaaatcctgcctcgtgctt
accgccggcggcgtgggctacgagctgcacctgcccctgccggcgctggccagactgccg
gccgaaggtcaggaggtgagcttccataccgagcaggtcgtgcgcgaggacagccaggat
ctctacggcttcgaaacttccgaagagcgccggctgttccatgtgctgctgagcatcccc
aatttggggcccaagaaagggctggccattctctcccaattccatcccgacgacctgcgc
cagatcgtgctgcacgaggatatcgcggcgttgacccgagtctcgggcatcggcaagaag
accgggcagcaaattctctgggaactcaagtacaaactcgcctcggccgatgctcccgcc
gtgggccgcaaaccggccgcgcctgggcgcagcgtgctgcaggatgccctggcgggtctg
accaatctggggtacagcgaggaggaggccagacctgttctgcataaattattcgaggcc
gagccggacctggatgtagcccagctcctgcgcgaagccctaaaagccatagccaaggcg
cgcgcctaa

DBGET integrated database retrieval system