KEGG   Desulfovibrio africanus: Desaf_0114Help
Entry
Desaf_0114        CDS       T01662                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
daf  Desulfovibrio africanus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desaf_0114
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desaf_0114
Enzymes [BR:daf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Desaf_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126741..127733
Genome map
AA seq 330 aa AA seqDB search
MLNHKSVQVIGVPLDLGVSKLGVDMGPTALRYAGIFEALRYAGIDYRDAGDIDVLRNFSL
DPLSPAEREQAKLREIIRTSETLARFTAKAIEDGHMPIVLGGDHSTAIGSVAGAAKARGR
IGLIWIDAHPDANTPETSPSGNVHGMPLAISLGHGMPELVNCLGFAPKVRPEDVCIVGAK
DIDPEERKFLTRMGIRMFTTFDIENRGLARVMQEAVDVVSRGTNGVYVSFDADVMDKRVA
PGTGITTRGGLTYREISFIMRSIGAGVELIGFDIIEVNPLLDKANGTAELCVELAMAMLG
VKYTDYEKKYLASNRPGQERNGRNDGKPDR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatcacaaatccgtgcaagtcatcggcgtgcccctggatctgggagtcagcaag
ctcggcgttgacatgggccctactgccctgcgctacgcaggcattttcgaagccttgcgc
tatgcaggcatagactaccgcgacgccggtgacatcgacgtgctgcgcaacttttccctg
gacccgctgtctccggccgagcgcgagcaggccaagctgcgcgagatcatccgcacgtcc
gaaaccctggcccgtttcacggccaaggccatagaggacgggcatatgcccattgtgctg
ggcggcgatcactccacggccatcggctccgtggccggagcggccaaggctcgcggccgc
atcggtctcatctggatcgatgcgcatcccgacgccaacacgcccgaaacgagccccagc
ggcaacgtgcacggcatgcccctggccatctcgcttggtcacggcatgccggagttggtg
aactgcctgggtttcgcacccaaggtgcggcccgaggacgtgtgcatcgtgggcgccaag
gacatcgatcccgaggagcgcaaattcctgacgcgcatgggcatccgcatgttcacgacc
ttcgacatcgagaaccggggtctggccagggtcatgcaggaggccgtggacgtcgtcagc
cgcggcaccaacggcgtgtacgtgagcttcgacgccgacgtcatggacaagcgcgtggcg
ccgggcacgggcatcaccacgcgcggcggcctgacctaccgcgagatatccttcatcatg
cgctccatcggagcgggcgtggagctcattggcttcgacatcatcgaggtcaatccgctg
ctcgacaaggccaacggcacggccgagctgtgcgtggaactggccatggccatgctcggg
gtcaagtacacggactatgagaagaaatacttggcctccaatcgcccaggacaggagcgc
aacggccggaacgatggcaagcccgacagatga

DBGET integrated database retrieval system