KEGG   Desulfovibrio africanus: Desaf_0237Help
Entry
Desaf_0237        CDS       T01662                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
daf  Desulfovibrio africanus
Pathway
daf00010  Glycolysis / Gluconeogenesis
daf00260  Glycine, serine and threonine metabolism
daf00680  Methane metabolism
daf01100  Metabolic pathways
daf01110  Biosynthesis of secondary metabolites
daf01120  Microbial metabolism in diverse environments
daf01130  Biosynthesis of antibiotics
daf01200  Carbon metabolism
daf01230  Biosynthesis of amino acids
Module
daf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
daf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaf_0237
  Energy metabolism
   00680 Methane metabolism
    Desaf_0237
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desaf_0237
Enzymes [BR:daf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Desaf_0237
Membrane trafficking [BR:daf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Desaf_0237
Exosome [BR:daf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Desaf_0237
  Exosomal proteins of melanoma cells
   Desaf_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: EGJ48595
UniProt: F3YTY9
Position
258213..258956
Genome map
AA seq 247 aa AA seqDB search
MHTLVLLRHGQSTWNLENRFTGWTDVGLTNAGVKEAHLAAKLLQDDGYSFDICYTSVLKR
AIKTLWIVMEDMDLMWLPVQRTWRLNERHYGALQGLNKAETAREHSEEQVHIWRRSYDVP
PPALEPSDPRFPGSDPRYKNLSDTELPRTESLKLTIERTLPYWFETIVPGIQAGKRVLIC
AHGNSLRGLVKHLDRVSDEDIPGLNIPTGIPLVYKLDANLRPIESFYLGDQEEISKAQAA
VASQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
ttgcacaccctcgtcctgttacgccacggccaatccacatggaatctggagaaccgcttc
acgggctggaccgatgtcggcctgaccaatgccggcgtcaaggaggcccatctggccgcc
aaactgctccaggatgacggctactccttcgacatctgctacacctcggtgctcaagcgc
gccatcaagaccctctggatagtcatggaggacatggacctcatgtggctgccggtccag
cgcacctggcggctcaacgagcgccactacggcgcgctgcaaggcctgaacaaggccgag
accgcccgcgagcacagcgaggagcaggtgcacatctggcgccgcagctacgatgtgcct
ccaccggccctggagccgtcggacccgcgatttccgggcagcgatccacgctacaagaac
ctgtccgacacggagctgccgcgcaccgaaagtctcaagctgaccatagagcgcaccctg
ccctactggttcgagaccatcgtgccgggcatacaagccggcaagcgcgtactcatatgc
gcacacggcaacagcttgcgcgggctggtcaaacacctggatcgcgtcagcgacgaagac
ataccgggtctgaacatccccacgggcattccgctggtctacaagctggatgcgaacctg
cggccgatcgagagcttctatctgggcgaccaggaggagatcagcaaggcccaggccgcc
gtggcctcccaaggcaaggcctga

DBGET integrated database retrieval system