KEGG   Desulfovibrio africanus: Desaf_0240Help
Entry
Desaf_0240        CDS       T01662                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
daf  Desulfovibrio africanus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Desaf_0240
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Desaf_0240
Enzymes [BR:daf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Desaf_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
261298..262443
Genome map
AA seq 381 aa AA seqDB search
MRALLISIVLFVALACAAGALTSGSGTASCDIGRDELAAMAGQMILVGFRGLELDEDSPI
AQDVRTGRVGGVILFDYDVLLKSPVRNVQSKEQLTRLTDALQRMAPLPLLVSVDQEGGKV
SRLKERHGFAVSPSAAELGRGTPDRTQIAAASLGRELAACGFNLDFAPVVDVNVNPGNPV
IGRLGRSFSADPTAVADHAAAFVRGLHSAGVLSALKHFPGHGSSASDSHLGLTDVSATWS
EKEIAPYRQLLAHGLVDVVMTGHLFNSALDPKHPGTLSRSTVQGLLRERLGFTGVVVSDD
LQMRAVADHYGLRETIRLALTAGVDVLLFGNNLDYDPLIARKAQSIILELVDSGELPCQR
ILESHERVMALKAKLAARSQR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctgcttatctccattgtgttatttgttgcccttgcctgtgcggccggggcg
ttgacatccggctccggtacagcatcctgcgatatcggccgtgatgagctggccgccatg
gcaggccagatgatcctggtcggctttcgagggctggagctggacgaagacagccccatc
gcccaggacgtgcgcacgggacgggtggggggcgtcatcctcttcgattacgacgtgctt
ctgaaaagcccggtgcgcaatgtgcaaagcaaggagcagttgacccggctcacggacgcg
ctgcagcgcatggccccgctgccgctgctggtgtccgtggaccaggaaggcggcaaggtg
tccaggctcaaggagcgtcacggcttcgccgtctcgccttcggcggccgaactggggcga
gggacgcccgaccgcacgcagattgccgccgcatccctgggcagagagctggccgcctgc
ggcttcaatctggacttcgcgcccgttgtcgacgtgaacgtcaatcccggcaatccggtc
atcggccgtctgggccgcagcttctcggccgatccaacggccgtggccgaccacgccgcg
gccttcgtgcgcggcctgcactcggcgggcgtgctctcggccctcaaacacttcccgggc
cacggcagctccgcatccgactcgcaccttggcctgacggacgtaagcgccacctggagc
gagaaggagattgcgccctacagacaactcctggcgcatgggctcgtggacgtggtcatg
accggtcacctgttcaactccgccctggacccgaagcatccgggcaccctctcgcggagc
acggtgcaagggctcttgcgcgaacggctgggcttcacgggcgtggtcgtctccgacgat
ctgcagatgcgcgccgtggccgaccactacgggctgcgcgaaaccatacgcctggccctg
acggcgggcgtggacgtgctccttttcggcaacaatttggactacgatccgctcatcgct
cgcaaggcccagagcataatactggagctcgtggactcgggcgagctgccctgtcaacgg
attctggagtcccacgagcgcgtcatggccctgaaggcgaagttggcggctcgcagccag
aggtga

DBGET integrated database retrieval system