KEGG   Desulfovibrio africanus: Desaf_0591Help
Entry
Desaf_0591        CDS       T01662                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
daf  Desulfovibrio africanus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:daf00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
658240..659235
Genome map
AA seq 331 aa AA seqDB search
MPEESLTIIGYVRSSLQRRTDAPKQGFEGGVQACVELEPEFTAGLDGVRPGQDLLLFTWL
HKARRDALLSHPRGDTSKPMAGVFSLRSPHRPNPVGMHRVRVLALDGSRLTVAPLEAIDG
TPVVDIKPVLDAEGRPALPDAPSLPEADAAILREAGERAWARGLVSGFNGNLSLRRGKTM
LITASGCAKGRLTQADIVHVRIADGTTLQGGPCSSETPMHLAVYRAVPGAQAIVHLHPRN
LLALSLMVSEDRLLALPLYEASAYRREMAFVPALNPGSQELAQAVAAALVERKAVFMHGH
GLTCRGRDVFSALHLAEELEGLATIQLLTLR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagagagcctgaccatcatcggatatgtccgctcctccctacagcgcaggact
gacgcgccgaagcagggcttcgagggcggcgtacaggcctgcgtggagctggagccggag
tttacggccggcttggacggcgtgcggcccggacaggatctgctgctgttcacctggctg
cacaaggcccgacgcgatgcgctcctgagccatccgcgcggcgatacctccaagcccatg
gccggcgtgttcagcttgcgctcgccccacaggcccaaccctgtcggcatgcatcgcgtg
cgcgtgctggcccttgacggctcgcgcctgaccgtcgcgcccctggaagccatcgacggc
acgcccgtggtggacatcaagcccgtgctcgacgccgagggcagacccgccctacccgac
gcaccgagcttgcccgaagccgatgccgcgatcctgcgcgaggctggcgagcgggcctgg
gccaggggcttggtcagcggcttcaacggcaacctgagcctgcggcgcggcaaaaccatg
ctcatcacggcctcgggttgcgccaaaggccgcttgacccaggccgacatcgtccacgtg
cgcatcgccgacggaacgacactccagggcgggccgtgctccagcgaaacgcccatgcat
ctggccgtataccgcgcagtgcccggagcccaggccattgtgcacctgcacccgcgcaat
ctgctggccctgagcctaatggtcagcgaggaccggctgttggccctgccgctctacgag
gcatcggcgtatcggcgcgaaatggctttcgttccggccctgaatcccggcagccaggaa
ctggcccaggccgtggccgcggccctggtcgagcgcaaggccgtattcatgcacggccac
ggtttgacatgccgagggcgggatgtgttttccgctctgcacctggccgaagaactggaa
gggctggccaccattcaattgctaaccttgcggtga

DBGET integrated database retrieval system