KEGG   Desulfovibrio africanus: Desaf_0713Help
Entry
Desaf_0713        CDS       T01662                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
daf  Desulfovibrio africanus
Brite
Enzymes [BR:daf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Desaf_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
766743..767858
Genome map
AA seq 371 aa AA seqDB search
MKLLFLALPSVYRLAAFVGVGIVLGAVLAPGTGLAQKTMQQEAAAIFRPIPENPPKLPGN
IVTPVKVELGRLLYFDPRLSASQLISCQTCHNVGLGGADLQETSIGHGWQKGPRNAPTTF
NSVFNVAQFWDGRAKDLAEQSKGPVQAAVEMNNTPDRVVATLASIPQYVDLFAKAFPGQR
NPVSFENMAQAIEAFEATLLTPGAPLDAFITGDESALTPTQQEGLRLFIDSGCSDCHYGI
NLGGMGYYPFGVAEAPSEDVRPTDDTGRFVVTNTASDKYVFKSPILRNVAITQPYFHSGK
VWRLRDAVQIMGSSQLGFELEGKDADIITEFLKALTGKQPEVAHPILPPSTESTPKPMTQ
LLPEKESGKKG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcctattccttgcacttccctccgtatataggctagccgcctttgtcggcgtc
ggcattgtcctgggcgctgttctcgcacccggcacgggtttggctcaaaagacaatgcaa
caggaagccgcggctatcttccggcccatccccgaaaatccgcccaagctgcccggaaat
atcgtcacgcccgtaaaggtcgagcttggccggctgctctatttcgacccgcgcctgtcg
gcctcccaactcataagctgccagacctgccacaacgtaggcctgggcggagcggacctc
caggagacctccatcggacacggctggcaaaaaggaccgcgcaacgcccccacgaccttc
aattccgttttcaacgtggcccagttctgggacggccgtgccaaggatttggccgaacag
tccaaaggtccggttcaggctgccgtggagatgaacaatactcccgatcgagtggtggcg
actctggccagcatcccccaatatgtggacctcttcgccaaggcctttcccggacagagg
aaccccgtgagcttcgaaaacatggcccaggccatcgaggcctttgaggccactctgctc
acccccggcgcaccgctggacgccttcatcaccggcgacgagtcagccttgacgcccacc
cagcaggaagggctgcgcctgttcatcgacagcggctgctccgactgccattacggcatc
aacctgggaggcatgggctattatcctttcggagtggcggaggccccaagtgaggatgtc
cgccccaccgacgataccggccgcttcgtggtcaccaacacagccagcgacaagtacgta
ttcaagtcgcccattctgcgcaatgtggccatcacccagccctacttccactcgggaaag
gtctggcggcttcgggacgcggtgcagatcatgggctccagccagcttggtttcgagctc
gagggcaaggatgccgatatcatcacagaattcctgaaagcgctaaccggcaaacaaccg
gaggtggcccatcctatcctgccgccctccaccgagagcacgcccaagccgatgacgcaa
ctgcttcccgaaaaggaatccggcaaaaagggttag

DBGET integrated database retrieval system