KEGG   Desulfovibrio africanus: Desaf_0847Help
Entry
Desaf_0847        CDS       T01662                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
daf  Desulfovibrio africanus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Desaf_0847
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desaf_0847
Enzymes [BR:daf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Desaf_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918647..919576
Genome map
AA seq 309 aa AA seqDB search
MEWPHKDLLDVGQLSREEAEHVFRTGRYFQEINARPVKKVPTLKGRTVVLFFAEPSTRTK
TSFDMAAKRLSADTFSLAKSGSSLTKGESLKDTAWTLQAMSLDALVIRHQASGAAQYLAE
RLECSVINAGDGWHAHPTQALLDAFTLYQEWGSVQGKTILILGDIAHSRVARSNVQLLTM
LGAKVRLCGPRTLMPSAVGGWPVEVGYNLDEAVRGVDAVMCLRLQLERQTSCLFPDGREY
ARSYCLGMRHLERANAGAKILHPGPINRGLEISSDVADCPDSLILDQVASGVAVRMALLF
LYVTRKEVE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaatggccgcataaggacctgctggatgttggacaactcagccgcgaggaagccgag
cacgttttccgcaccggccgatatttccaggagatcaacgccaggccggtgaagaaggtg
cccacgctcaagggccgcaccgtggtcttgttcttcgccgagccgagcacgcgcaccaag
acatccttcgacatggccgccaagcggctttcggccgacaccttttccctggccaagtcc
ggcagttcgctgaccaaaggcgaaagtctcaaggacactgcctggaccttgcaggccatg
agcctggacgccctggtcatacgccaccaggccagcggcgcggcccaatatttggccgag
cggctggagtgctccgtgatcaacgcgggcgacggctggcacgcccaccccacccaggcc
ctgctggacgcctttaccctgtaccaggaatggggttcggtgcagggcaagaccatccta
atactgggcgacattgcccacagccgcgttgcgcgttccaatgtgcagctgttgaccatg
ctgggcgcgaaagtgcgcctttgcggaccgcgcacgctcatgccttcggccgtgggaggc
tggcccgtggaggtcggctataacctggacgaggccgtgcgcggcgtcgacgccgtcatg
tgcctgcggctgcagcttgagcgccaaacctcctgcctgttcccggacgggcgcgagtac
gcgcgctcatactgcctgggcatgcgccacctggagcgggccaacgccggagcgaagatc
ctgcacccaggccccatcaaccgcgggctggagatctcctccgatgtcgcggactgcccg
gacagccttatcctcgaccaggtggccagcggcgtggccgtgcgcatggccctgcttttc
ctgtatgtgacgcgcaaggaggtcgaatga

DBGET integrated database retrieval system