KEGG   Desulfovibrio africanus: Desaf_0875Help
Entry
Desaf_0875        CDS       T01662                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
daf  Desulfovibrio africanus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:daf00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:daf00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:daf00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:daf00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(953491..954954)
Genome map
AA seq 487 aa AA seqDB search
MRKSPLLQQVFDYRALPESDRFKQFALKMEAHNLPPIVINIFKYYYSLLLSGSQGKMAEA
DITPISPDDLKDYLELDAYEAAGRKALPKVAIIKLNGGLGTSMGLETAKSLLAIKAETCF
LDVIIEQVERLRERYDIPVPLTLMNSFHTHSDSMLAIEGFDNGRTRVPLAFIQHMYPKIM
RDTFLPARWPKNPELEWNPPGHGDLYTAMVTSKTLKRLEESGFEYAFISNSDNLGAVMDL
KILGYMASEDLPFLMEVAQRTPADKKGGHLCKVKESGRLALREVAQCPDEELAEFQNIEK
YAFFNTNSIWINLKVLEKVFAYHGMMPLDLIANHKTLDPRDPDSPPVIQVETAMGSAISA
FHTAAAVRVPRTRFAPVKTSNDLLNVMSDNFILSTDYEIVPNPERNRSPVLVDLDPTFYK
KVDDFQDRFPEGVPSLLNCTTFTVRGDVRFKGGVACRGNVLVENRTGHQVVVGPEDLAEE
NAQLVLE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagtccccgcttttgcagcaagtcttcgattatcgggccctccccgagtcggat
cgtttcaagcaattcgccttgaagatggaagcgcacaacctgccgcccatcgtcatcaat
atattcaagtattactacagtctgcttctctcgggttcccaaggcaaaatggccgaagct
gatataacgcccatcagcccggacgacctcaaggactacctggagctcgacgcctacgag
gccgccggccgcaaggccctgcccaaggtggccatcatcaagctcaacggcggcctgggc
acgagcatgggcctggagacggccaagtcgctcctggcgatcaaggccgaaacctgcttc
ctggacgtgatcatcgagcaggtggagcggctgcgcgagcgctacgacatccccgtgccg
ctaacgctcatgaatagctttcacacgcacagcgactccatgctggccatcgagggcttt
gacaacggacgcacccgcgtgcctctggccttcatccagcacatgtaccccaagatcatg
cgcgacacgttcctgcccgcgcgctggcccaagaacccggagctcgaatggaacccgccg
ggccatggcgacctctacacggccatggtgacctccaagaccctcaagcggctcgaggag
agcggcttcgagtacgcctttatttccaactcggacaacctgggcgcggtcatggacctc
aagatcctgggctacatggcctccgaggatctgccattcctcatggaagttgctcagcgg
actcccgcggacaagaagggcggccatctgtgcaaggtcaaggaatccggccgcctggcc
ctgcgcgaggtggcccagtgcccggatgaagagctcgccgaattccagaacatagagaag
tacgccttcttcaacaccaactccatctggattaacctcaaggtgctggagaaggtcttc
gcctatcacggcatgatgccgctggatctcatcgccaaccacaagaccctggacccgcgc
gatcctgactcgcccccggtgatccaggtggaaacggccatgggctcggccatttcagcc
ttccacacggccgcggccgtgcgcgtgccgcgtacgcgcttcgcgccggtcaagacgagc
aacgacctgctcaacgtcatgtccgacaactttatcctttccacggactacgagattgtg
cccaatcccgagcgcaaccgcagccccgtgctcgtcgatctcgatccgacgttctacaag
aaagtggacgacttccaggaccgcttccccgaaggcgtgccttcgctgctcaactgcacc
acgttcacggtcaggggcgacgtgcgcttcaagggcggcgtggcatgccgcggcaacgtg
ctcgtggaaaaccgcaccggccatcaggtcgtggttggccccgaggatcttgcggaggag
aacgcgcagctggtcttggagtag

DBGET integrated database retrieval system