KEGG   Desulfovibrio africanus: Desaf_1044Help
Entry
Desaf_1044        CDS       T01662                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
daf  Desulfovibrio africanus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:daf00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:daf00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:daf02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154284..1155783
Genome map
AA seq 499 aa AA seqDB search
MDCRNRKQFLARLLLALAVAGGVLVLGSTEAMAKAKYVFLFIGDGMGLPQSNAAEMYKAS
LAGFDKPGIVKLNFNEFPAQGMTTTYSIDSLITDSAAAGTAMASGVKTTNAGVGVDGRNK
PVKTIAEMARDAGYKVGIVSSVSLDHATPAAFYAHQPTRKNMYEISMELSKSGFDYFAGG
GLVDPEGKKSKMQGEKVNAIEAARKAGYAVVNDVAGFKALKPGQKAMFINPRLQDSQAMA
YAMDNAHGDVTLADLTAKGIELLDNKKGFFMMVEGGKIDWACHANDALASIKDTLAFEDA
VAKAIAFYKKHPKDTLIIVTGDHETGGLTLGFAGTKYESHFSRLNGQKVSYVAFDEKFEA
LKKTNPRFEQAMAMVEQDFGLKATGDAKDPMVLKDYEMASLKDAFARTLAGDYEKSKNDQ
EYLLYGGYNPFSVTVTHILNQKAGLAWTSYSHTGVPVLTTAIGAGSEKFNGFYDNTDLFL
KMTENMGLKSKIIYLSQAN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggattgccgcaaccgcaaacaatttctggcgcgcctgctcctggccctggccgtggcc
ggcggcgtgcttgtgctcggctcgaccgaggccatggccaaggccaagtacgtattcctg
ttcatcggcgacggcatgggcttgccccagagcaacgccgccgagatgtacaaggcctca
ctggccggcttcgacaagcccggcatcgtcaagctgaacttcaatgagttcccggcccag
ggcatgaccacgacctactccatcgactcactcatcaccgactcggccgcggccggcacg
gccatggcctcgggcgtcaagaccaccaacgcaggcgtgggcgtggacggcaggaacaag
ccggtcaagaccatcgccgagatggcccgcgacgccggctacaaggtcggcatcgtgtcc
agcgtgtccctggatcacgccaccccggccgctttctacgcccaccaacctacccgcaag
aacatgtacgaaatctccatggagctttcgaagagcggcttcgactacttcgccggcggc
ggcctcgtggaccccgagggcaagaagtcaaaaatgcagggcgaaaaggtcaacgccatc
gaagcggcccggaaggccggctatgcggtggtgaacgacgtggcaggattcaaggccctc
aagcccggccagaaggctatgttcatcaatccccgcctgcaggactcccaggccatggcc
tacgccatggacaacgctcatggcgacgtgaccctggccgacctgaccgccaagggcatc
gagttgctggacaacaagaaaggcttcttcatgatggtcgagggcggcaagatcgactgg
gcctgtcatgccaacgacgccctggcctccatcaaggacaccctggccttcgaggacgcc
gtggccaaggccatcgcgttctataagaagcatcccaaggatacgcttatcatcgtgacc
ggcgaccatgagactggcggccttaccctgggcttcgccggcaccaagtacgagtcccat
ttctcccgcctgaacggccaaaaggtctcctacgtggccttcgacgagaaattcgaggct
cttaaaaagaccaacccgcgcttcgagcaggccatggccatggtcgaacaggattttggc
ctcaaggccacgggcgacgccaaggaccccatggtgctcaaggactacgaaatggcctcc
ctcaaggacgccttcgcccgcaccctggccggcgattacgagaagtccaagaacgaccag
gagtacctgctctacggcggctacaaccccttcagcgtaaccgtcacgcacatcctgaac
cagaaggccggcctggcttggacctcctactcgcacaccggcgtgcccgtgctgaccacg
gccatcggcgccgggtccgagaaattcaacggcttctacgacaacactgacttgttcctg
aagatgaccgagaacatgggcctcaagtccaagatcatctacctgtcccaggccaactag

DBGET integrated database retrieval system