KEGG   Desulfovibrio africanus: Desaf_1251Help
Entry
Desaf_1251        CDS       T01662                                 

Definition
butyrate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
daf  Desulfovibrio africanus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desaf_1251
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaf_1251
   00620 Pyruvate metabolism
    Desaf_1251
   00640 Propanoate metabolism
    Desaf_1251
  Energy metabolism
   00680 Methane metabolism
    Desaf_1251
Enzymes [BR:daf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desaf_1251
Lipid biosynthesis proteins [BR:daf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desaf_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1382740..1384389
Genome map
AA seq 549 aa AA seqDB search
MHKPSPVSYEDFKDKFSLEVPEGYNFAFDFLDAEAAKDPTRPAMVHIDPEGKRRDYDLAF
FSRESAKLANALVAQGLKRGDRVMVILYRRVEFWVTMLALHKIGAVPIPSPNLLTAKDIE
QRINYAKVRAVVCEYTLTERVEQARPKCPTLQILVQVAGDKLPAGWVGYNAILQKAGDSY
PAPKGKDKPGGDDPLLIFFTSGTTGMPKMAEHTHAYALGHYVTGVYWHDLGPSDLHLTLA
DTGWGKAVWGKFYGQWMAGATVFTWDFRGKFEPEHLLRLMAEHKVTSFCAPPTVYRFLIR
LDLSQFDLSALRHCTTAGELLNDGVFHEWKRMTGLPIYEGYGQTETTLQLLTLPCMTPKP
GSIGRPAPGWDLRLLKEDGSPCAPGEEGEICIAVEPKRPVGLFTGYLDEPAKTAAVIYDG
FYHTGDKAWMDEDGYFWFLGRTDDLIKSSGYRIGPFEVESALITHPGVVEAAVTGVPDPV
RGQAVKATVVLAKGYDPSDELTHEIQEHVKKVTAPYKYPRVIEYVDELPKTISGKIKRAE
IRERDEKKG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcataagccttcgcccgtgtcatacgaggatttcaaggacaagttctccctggaggtg
cccgaaggctacaatttcgccttcgacttcctggacgccgaggcggccaaggaccccacg
cggccagccatggtgcacatcgaccccgagggcaaacgccgcgattacgacctggctttt
ttcagccgcgagtcggccaagctggccaacgccctggtcgcccagggcctcaagcgcggc
gaccgggtcatggtcatcctctaccgccgcgtggagttctgggtgaccatgctggccctg
cacaagatcggcgcggtgcccattccctcgccgaacctgctcacggccaaggatatcgag
cagcgcatcaactacgccaaggtgcgcgccgtggtctgcgagtacacgctcaccgagcgc
gttgagcaggccaggcccaagtgcccgacgctgcaaatcctggttcaggtggccggcgac
aagctcccggccggctgggtgggctacaacgccatcctgcaaaaagccggggacagctat
cccgcgcccaagggcaaggacaagccgggcggtgacgacccgctgctgattttcttcacc
tcgggcaccacgggcatgcccaagatggccgagcacacccacgcttatgccctgggccac
tacgtcacgggcgtttactggcacgacctgggaccgagcgacctgcacctgaccctggcc
gacacgggctggggcaaggcggtctggggcaagttctatgggcagtggatggccggtgct
acggtcttcacctgggattttcgcggcaagttcgagcccgagcacctgctgcggctcatg
gccgagcacaaggtcaccagcttctgcgcgccgcccacggtctaccgcttcctcatccgc
ctggacctgtcgcagttcgacctgtcggccctgcgccactgcaccacggccggcgagctg
ctcaatgacggcgtgttccacgagtggaagcgcatgaccggcctgcccatctacgagggc
tacggccagaccgagacgaccctgcaacttctcacgctgccctgcatgacgcccaaaccc
ggctccatcggccggcccgcgcccggctgggacctccgcctgctcaaggaggatggctcg
ccctgcgccccgggcgaagagggcgagatctgcatcgccgtggagcccaaacggcccgtg
ggcctgtttaccggctacctggacgagccggccaagaccgccgccgtgatttatgacggc
ttctatcacaccggcgacaaggcctggatggacgaggacggctacttctggttcctgggc
cgcaccgacgacctcatcaagtcctcgggctaccgcatcggacccttcgaggtggaaagc
gcgctcatcacccacccgggggtggtggaggcggccgtgaccggcgtgcccgaccccgtg
cgcggccaggccgtcaaggccaccgtcgtgctggccaagggctacgacccgagcgacgag
ctgacccacgaaatccaggagcacgtcaagaaggtcaccgcgccctacaagtacccgcgc
gtcattgagtacgttgatgaattgcccaagaccatctcgggcaagatcaagcgcgccgag
atccgggagcgggacgagaagaaaggctaa

DBGET integrated database retrieval system