KEGG   Desulfovibrio africanus: Desaf_1391Help
Entry
Desaf_1391        CDS       T01662                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
daf  Desulfovibrio africanus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:daf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:daf00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:daf00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:daf00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:daf00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1556715..1558634
Genome map
AA seq 639 aa AA seqDB search
MDDTGALDVLLNEVRVFRPLPQTIIEANVNPQEVTGAYRLAQEDPLAYWEEAALELEWFR
KWDRVLDSDNPPFYRWFPGGQCNIVHNALDRHIRTVNRNKLALIWEGEPGDSRKFTYFEL
YRAVNRFAGALRSLGVRKGDRVAVFMPLLPETLIAMLATAKIGAVHVCVFGGFSAKALSE
RICDSQARVVVTADGFYRNGKVINQKAIVDEALNSACADCVDTVVVVHRAGVDVDMVSAR
DIWYEDLVRSEAPETRTEVMEATDPLFLLHTSGTSGRAKGIVHTHGGYMVGVARTMNWIF
DIKPTDIFWCTADAGWITGHSYVVYAPLLCGTTTLMYEGHPLYPQADRLWSIVARYGVTA
LYTTPTLIRMLMRYGSQFPRQHDISSLRMLGSVGEPLNPEAWVWFHRHIGRGECPLMDTW
WQTETGMCMLSPLPVSVLKPGSVNKPLPGVEAEVVDRQGQPVPPGKGGFLVLTKPWPGML
QTLWNDPKGYAQAYWEKIPGVYVTGDVARKDEDGYFWIQGRADEVINIAGHNIGTAEIES
ALCVHKAVAEAAVVGVPDKIKGEVAKAFVVLSEGRELGEDLVRELKAMVRRELGPVVVLK
SVAFVESLPRTKAGKILRRVLRAQELGVDPGDLSVLDEE
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaccggcgccctggacgtattgctgaacgaagtacgggtcttcaggcccctg
cctcagaccatcatcgaggccaacgtgaaccctcaagaggtaaccggcgcctacaggctg
gcccaagaggatccacttgcctactgggaagaggccgccttggagctcgaatggttccgc
aaatgggaccgcgtgctcgacagcgacaacccgcccttttaccgctggttccccggcggt
cagtgcaatatcgttcacaacgccctggatcggcatatccgcacggtgaaccgcaacaag
ctggccctcatttgggagggcgagccgggcgatagccgcaagttcacctatttcgaactc
taccgggccgtgaaccgtttcgccggcgcgctgcgctccctgggcgtgcgcaagggcgac
cgcgtggccgtgttcatgccgctattgcccgagacgctcatcgccatgctggccacggcc
aagatcggggccgtacacgtgtgcgtgttcggcggcttctcggccaaggccctaagcgag
cgcatctgcgatagccaggcccgcgtggtggtcacggccgacggtttctaccgcaacggc
aaggtcatcaaccagaaggccatcgtggacgaggccctgaacagcgcctgcgccgactgc
gtggacacggtggtcgtggtgcatcgggccggcgtggacgtggacatggtctcggcgcgg
gacatctggtatgaggacctggtgcgctccgaagccccggaaacgcgcactgaggtcatg
gaggccacggacccgctgttccttttgcacacatcgggcacctcgggccgggccaagggc
atcgtgcacacccacggcggctacatggtcggcgtggcccgcaccatgaactggattttc
gacatcaagcccacggacatcttctggtgcacggccgacgcgggctggatcacgggccac
agctacgtggtctacgcaccgctgctgtgcggcaccaccacgctcatgtacgaggggcac
cccctgtacccgcaggccgaccgcctatggtcgattgtggcccgctacggcgtcacggcg
ctgtacaccacgcccacgctcatccgcatgctcatgcgctacggcagccagttccccagg
cagcacgacatttcgtcgctgcgcatgcttggcagcgtgggcgagccactgaatccggaa
gcctgggtctggttccaccggcatatcggccgcggcgagtgcccgctcatggatacctgg
tggcagaccgagacgggcatgtgcatgctctcgcccttgcccgtgtccgtgctcaagccc
ggctcggtgaacaaaccgctgcccggcgtggaagccgaagtggtcgaccgtcagggccag
cccgtgccgcccggtaaaggcggtttcctggtgctgaccaagccgtggcccggcatgctc
cagaccttgtggaacgatcccaaaggctacgctcaggcctattgggaaaagattccgggc
gtgtacgtcacgggcgacgtggcgcgcaaggacgaggacggttatttctggattcagggc
cgggccgacgaggtcatcaacatcgccgggcacaacatcggcacggccgagatcgagtcg
gccctctgcgtacacaaggccgtggcggaagccgcggttgtgggcgtgccggacaagatc
aagggcgaggtcgccaaggcctttgtcgtcctgtccgagggtcgcgaactgggcgaggac
ctggtgcgcgaactcaaggccatggtccggcgcgagctgggacccgtggtggtgctcaag
tcggtggctttcgtggagtccctgccgcgcaccaaggcgggcaagattctgcgccgcgtg
ctgcgcgcccaggaactgggcgtggatcccggcgatctgtccgtgttggacgaggaatga

DBGET integrated database retrieval system