KEGG   Desulfovibrio africanus: Desaf_1509Help
Entry
Desaf_1509        CDS       T01662                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
daf  Desulfovibrio africanus
Pathway
daf00010  Glycolysis / Gluconeogenesis
daf00052  Galactose metabolism
daf00500  Starch and sucrose metabolism
daf00520  Amino sugar and nucleotide sugar metabolism
daf00521  Streptomycin biosynthesis
daf01100  Metabolic pathways
daf01110  Biosynthesis of secondary metabolites
daf01120  Microbial metabolism in diverse environments
daf01130  Biosynthesis of antibiotics
daf01200  Carbon metabolism
Module
daf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
daf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaf_1509
   00052 Galactose metabolism
    Desaf_1509
   00500 Starch and sucrose metabolism
    Desaf_1509
   00520 Amino sugar and nucleotide sugar metabolism
    Desaf_1509
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desaf_1509
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Desaf_1509
Enzymes [BR:daf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Desaf_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: EGJ49846
UniProt: F3Z0M2
Position
1683194..1684144
Genome map
AA seq 316 aa AA seqDB search
MKRILAADIGGTNSRFASFTTDGLSLVLEDMLRLPTKQFGSFLELVDALEGEGFPASLRR
SDMTVIAVAGAVRERVYAKPPNIPWEIDFSHGREIFGEGGYFLINDFVAQAFGCQTDAAV
GAREIKPGTAQEDAALAAIGAGTGLGHCALLPDLCGGYIAAPSEAGHASFAFMGPEEQEY
ERFLLARTGKPYAYGDIVVTGLGLSLVHGFLTGEDLDPAGVSARLTEDCATTAWFARFYG
RACRNYALSVLAMRGVHVVGGVAAKNPMLVMHPNFRQEFVESPNYGWLLREIPVYLNDNE
DSGLWGAAFYGLMNLR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggattctggccgcggatatcgggggaaccaacagccgattcgcctcctttacg
accgatggcttgagcttggtcctggaggatatgctgcgtttgcccaccaagcagttcggg
tcgttcctggagttggtggacgccctggaaggcgaagggtttccggcctccctccggcgc
agcgacatgacggtcatcgccgtggccggcgcggtgcgcgagcgggtctacgccaagccg
cctaacataccctgggagatcgacttctctcacggccgggagatattcggcgagggcggt
tacttcctcattaacgacttcgtggcccaggccttcggctgtcagaccgacgcggcagtc
ggcgcgcgcgagatcaagcccggcactgcccaggaggacgcggctctggccgcaataggc
gcaggcacgggccttggccattgcgcgctgctgcctgacctgtgcggcggatacatcgcc
gcgccgtcagaggcgggccatgcctccttcgccttcatggggcccgaggagcaggagtac
gagcgcttcctgctggccaggaccggcaagccctacgcctatggcgacatcgtggtcacc
ggccttgggctgtcgcttgtgcacggctttttgaccggcgaggatctggaccctgccggg
gtctcggcccgcctgacggaagactgcgccaccacggcctggttcgcgcgcttctacggc
cgggcctgccgcaactacgccctgagcgtgctggccatgcgcggcgtccatgtggtagga
ggcgtggcggccaagaatcccatgctggtcatgcacccgaacttccgccaggagttcgtg
gagtcgccgaattatggctggctgctgcgtgagatcccggtgtacctgaacgacaacgag
gacagcgggttatggggagcagccttttacggtctcatgaacctgcgttga

DBGET integrated database retrieval system