KEGG   Desulfovibrio africanus: Desaf_1715Help
Entry
Desaf_1715        CDS       T01662                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
daf  Desulfovibrio africanus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Desaf_1715
Enzymes [BR:daf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Desaf_1715
Transfer RNA biogenesis [BR:daf03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Desaf_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1913141..1913908
Genome map
AA seq 255 aa AA seqDB search
MAEIALDSLKAAFIEAAQAAGREILRVYGTQFGVERKADDSPLTEADKAAHAAIKAVLTE
RFPDIPILSEEGRHLPYNERKHWPRMFVVDPLDGTKEFVKRNGQFTVNIALVEHQRPVLG
IIGVPVQGLLYWGGPDIGAFRVEDGRETPISTRKPDPGQGHVVLESVSHKSPDMDAYLAT
LHVRQRVEVGSALKFCVLAEGKADLYPRFNLTYEWDTAAGHAIVLGAGGSFTGLDGGPFL
YNKENLKNPGFVAKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatagcgctggacagtctcaaagcggctttcatcgaggccgcgcaggcagcg
ggcagggagatcctgcgcgtgtacggcacgcaattcggggtggaacgcaaggccgacgac
tcgccgctgacagaggcggacaaggcggcccacgcggccatcaaggccgtgctgaccgaa
cgattcccggacatccccatcctatccgaggaaggccgccacctgccctacaatgagcgc
aagcactggccgcgcatgttcgtggtggacccgctggacggcaccaaggaattcgtcaag
cgcaacggccagttcacggtcaacatcgccctggtggagcaccagcgcccggtcctgggc
atcatcggcgtgcccgtgcagggcctgctctactggggcgggccggacatcggcgcgttc
cgcgtggaggacggccgggaaacgcccatcagcacgcgcaagcccgatccgggccaaggg
catgtcgtactggagagcgtctcgcacaagagcccggacatggatgcgtatctggccacg
ctgcacgtaaggcagcgcgttgaggttggcagcgcgctcaagttctgcgttctggccgaa
ggcaaagcggacttatatccgcgcttcaatttgacgtatgagtgggacaccgccgccggg
catgcgattgtgctgggcgcgggtgggagttttacggggttggacggggggccgttcctc
tacaacaaagagaatttgaagaatccggggttcgtggcgaaagggtaa

DBGET integrated database retrieval system