KEGG   Desulfovibrio africanus: Desaf_1719Help
Entry
Desaf_1719        CDS       T01662                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
daf  Desulfovibrio africanus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:daf01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:daf00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:daf00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1916458..1918629)
Genome map
AA seq 723 aa AA seqDB search
MSQRVQAGRLAVSKPLHDTIAAIAPGTGISADAFWSALEQIVVDMGPRSRELLNKRQVLQ
DKIDAWHREHKAHDHAAYKKFLLDIGYLVPEGDNFSITTANVDDEIARIAGPQLVVPITN
ERYALNAANSRWGSLYDALYGTDVISQEGEAKRGYDPERGKQVMRRAGEFLDASAPLAMG
SHAQAVRYGLEDAGGRKSLVVELQGGERVGLKKSEQFAGYVGGSEPSLILLVNHGLHIEL
HIDRKDTIGKDHPAGIKDVVLEAALTTILDCEDSVAVVDGADKAQAYRNLLGLFRGDLQA
RFEKGGSFVTRTLQPDRTYTAPDGSALTLHGRSLMLVRTVGLLMTTPAVLLDNKEIPENM
LDTLATAFIGQHDIKGTGPLKNSRAGSVYMVRPKMHGPEEVAFACELFTRVEQALGIAKG
TLKIGVMDEERRTSVNLKECIRQAKERIIFINTGFLDRTGDEIHTDMEAGPMVRKNDMKA
QPWMPAYEDLNVDVGLEAGFSGKAQVGKGMWAKPDRMREMLETKIGHPQSGANCAWVPSP
TAATLHATHYHQVDVFARQKELAGKRRGSLDDLLTLPVMKDDRPSAKDVQEELDLNAQSI
LGYVVRWVEQGIGCSKVPDLTNVGLMEDRATLRISSQAIANWLHHGICTKEQVLETLKRM
AKVVDGQNAGDAMYRPMAKDYEGSVAFQAACDLVFKGREQPSGYTEPILHARRLEAKRKF
GIA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagagtgcaggcaggcaggctcgcagtttccaagccgctccacgacactatc
gccgcaatcgctccgggaaccggcatctcggcggacgcgttctggagcgccctggagcaa
atcgtcgtcgacatgggaccgcgcagcagggagctgctgaacaaacggcaggttttgcag
gacaagatcgacgcctggcaccgggagcacaaggcccacgaccacgcggcctacaagaaa
ttcctcctggacatcggatacctggtgcccgagggcgacaacttcagcatcaccacggcc
aacgtcgatgacgagatcgcccgcattgccgggccgcagctagtggtgcccatcaccaac
gaacgctacgccctcaacgcggccaactcccgctggggcagcctgtacgacgcgctgtac
ggcacggacgtcatctcgcaggaaggcgaggccaagcgcggctatgatcccgagcgcggc
aagcaggtcatgcgccgcgcaggcgagttcctggatgcgtccgcgccgctggccatgggc
agccatgcccaggccgtgcgctacggcctggaggacgcaggcggccgcaaaagcctcgtt
gtcgaattgcagggcggcgagcgcgtgggcctgaagaagtcggagcagttcgccggttat
gtgggcgggagcgagccgtcgctcatcctgctcgtgaaccacggcctgcatatcgagctg
cacatcgaccgcaaggacaccatcggcaaggaccatccggccgggatcaaggacgtggtg
ctggaagcggctctgaccaccatcctggactgcgaggactccgtggccgtggtggacggc
gcggacaaggcccaggcctaccgcaacctcctcgggctgtttcggggcgatttgcaggcg
cgcttcgagaagggcggctcattcgttacgcgcaccctgcagccggaccgcacctacacc
gcgcccgacggctccgcgctgaccctgcacggccgcagcctcatgctcgtgcgcacggtc
ggcctgctcatgaccacgcccgccgtgctcctagacaacaaggaaatccccgagaacatg
ctcgacacgctggccacggcctttatcggccagcacgacatcaagggcacgggcccgctc
aagaacagccgcgcgggcagcgtgtacatggtccggcccaagatgcacggccccgaggag
gttgcctttgcctgcgagctgttcacgcgcgtggagcaggccctgggcatcgccaaaggc
accctcaagatcggcgtcatggatgaggagcggcgcacctcggtcaacctcaaggagtgc
atccgccaggccaaggagcgcatcatcttcatcaacaccggcttcctggaccgcacgggc
gacgagatccacacagacatggaggccgggcccatggtgcgcaagaacgacatgaaggcc
cagccgtggatgccggcgtatgaagacctgaacgtggacgtcggcctggaggcgggcttc
tcgggcaaggcccaggtcggcaagggcatgtgggccaagcccgaccgcatgcgcgagatg
ctggagaccaagatcggtcacccgcagtccggcgcaaactgtgcctgggtgccctcgccc
accgccgccacgctgcacgccacgcactaccatcaggtggacgtgttcgcgcgccagaag
gagctggccggcaagcgccggggcagccttgacgacctgctgaccctgccggtcatgaag
gacgacaggccgtcggccaaggacgtgcaggaagagctggacctcaacgcgcagtccatc
ctgggctacgtcgtgcgctgggtcgagcagggcatcggctgctccaaggtgccggacctg
accaacgtgggcctcatggaggaccgcgccacgctaaggatttcaagccaggccatcgcc
aactggctgcaccatggaatctgcacgaaagagcaggtgctggagacgctcaagcgcatg
gccaaggtcgtggacgggcagaacgcgggggatgcgatgtaccggcccatggccaaggat
tatgagggtagcgtggcgttccaggcggcgtgcgatctggtttttaaaggcagagagcag
ccgagcggatataccgagccgatattgcatgcgaggcggttggaggcgaagaggaagttt
gggatagcgtag

DBGET integrated database retrieval system