KEGG   Desulfovibrio africanus: Desaf_1739Help
Entry
Desaf_1739        CDS       T01662                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
daf  Desulfovibrio africanus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Desaf_1739
Enzymes [BR:daf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Desaf_1739
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Desaf_1739
Lipid biosynthesis proteins [BR:daf01004]
 Fatty acid synthase
  Component type
   Desaf_1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1941402..1941980
Genome map
AA seq 192 aa AA seqDB search
MAENEKPVLLALGDSLTAGYGLDMGKAWPEQVQEMLQKDGYDMRVVNAGVSGDTSAGGLA
RLDWALQDKPAYAVVALGANDMLRGLAPETMQRNLEAILTRLEQQGVCALLAGMHAAPNL
GRDYVQRFNAVFPRLAEKHGAYFYPFLLQDVAAESDLNLGDGIHPNEAGARIIAERLYPL
IEKMIKQGCPAR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaatgagaagcctgtgctcctggccttgggcgacagcctgacggccggctac
ggcctggatatggggaaggcctggcccgaacaagtccaggagatgctacaaaaggatggg
tacgacatgcgcgtggtcaacgccggtgtgtccggcgacacctcggccgggggccttgcg
cgcctggactgggcgttgcaggataagcccgcttacgccgtggtggcccttggggccaac
gacatgctacgcgggctggcgccggaaaccatgcagcgcaacctggaggccatcctgacc
aggctggagcagcagggcgtctgcgctttgctggccggcatgcatgccgcacccaacctc
ggccgcgactacgtgcagcgcttcaacgcggtctttccccgcctggccgagaagcacgga
gcttatttctatcctttcctgctgcaggacgtggccgcggaaagcgacttgaacctgggc
gacggcatccaccccaacgaggccggagcccgaatcatcgccgagcgcttgtatccgctc
atcgaaaagatgatcaagcaggggtgtccggcgaggtag

DBGET integrated database retrieval system