KEGG   Desulfovibrio africanus: Desaf_1752Help
Entry
Desaf_1752        CDS       T01662                                 

Definition
aspartate transaminase
Orthology
K11358  
aspartate aminotransferase [EC:2.6.1.1]
Organism
daf  Desulfovibrio africanus
Pathway
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Desaf_1752
   01230 Biosynthesis of amino acids
    Desaf_1752
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desaf_1752
   00270 Cysteine and methionine metabolism
    Desaf_1752
   00330 Arginine and proline metabolism
    Desaf_1752
   00350 Tyrosine metabolism
    Desaf_1752
   00360 Phenylalanine metabolism
    Desaf_1752
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desaf_1752
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Desaf_1752
Enzymes [BR:daf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Desaf_1752
Amino acid related enzymes [BR:daf01007]
 Aminotransferase (transaminase)
  Class I
   Desaf_1752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1955316..1956500
Genome map
AA seq 394 aa AA seqDB search
MAMLASQIKDYLERASWIRRMFEAGIELKKQFGEDAVFDFSLGNPDLPPPPAVKKALAEI
AENADKPFALGYMPNPGYPDVRAALAAQLSQEQGVTVGAGDVILTCGAAGGLNAFFRAVL
EPCDEVLCPAPFFVEYGFYVQNFGGGLAPVKALPPDFGLDVPAMAAAINAKTRVVLINSP
NNPTGAIYPREQLQALAQALREKSAQFGRPIYLVSDEPYRFLAYDGAEVPSLLPIYEHSV
VASSFSKNLSLAGERVGYLLVNPAMPGKAELLAGLTLTNRILGYVNAPAIGQKILAKALG
SQVDVSIYAARRKAMAEVLDAAGIEYAMPKGGFYFFPKAPGGDDLAFVRRLQEERVLAVP
GTGFGYPGFFRLAFCVDEKIIRRSVEGFARAMKG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccatgctcgccagccagatcaaagactacctggagcgcgcctcgtggatccggcgc
atgttcgaagccggtattgagctcaagaaacagttcggcgaagacgccgtgttcgacttc
agtctcggcaaccccgacctgccgccgcccccggccgtgaagaaggccctggccgaaatc
gccgaaaacgcggacaagcccttcgccctgggctacatgcccaaccccggctacccggac
gtgcgtgcggcccttgcggcccagctttcccaggaacagggcgtgacagtgggtgcgggc
gacgtgatcctgacctgcggcgcggccggagggctcaacgcctttttccgagccgtgctg
gagccctgcgacgaggtgctctgccctgcgccgttcttcgtggagtacggcttctatgtg
cagaactttggcggcgggctggccccggtcaaggcgttgcccccggacttcggcctggac
gtcccagccatggccgcggccatcaacgccaagacccgcgtggtgctgatcaactcgccc
aataatcccacgggagccatctacccgcgcgagcagttgcaggcgttggcccaagccttg
cgcgaaaagtccgcgcagttcggccggcccatctatctcgtgtccgacgagccttaccgt
ttcctggcctacgacggagccgaggttccgagcctcctgcccatctacgagcattcggtg
gtggccagctccttctccaagaatctttccctggccggcgagcgcgtgggctatctgctg
gtcaatccggccatgcccggcaaggccgaactgctggccggcctgacgctcaccaaccgc
atcctgggctacgtgaacgcaccggccatcggccagaagatcctggccaaggccctgggc
tcgcaggtggacgtgtcaatctacgcggcgcggcgcaaggccatggccgaggtgctcgat
gcggcgggcatcgaatacgccatgccgaagggcggcttctacttcttccccaaggctccg
ggcggcgacgatctggcctttgtccggcggctgcaggaggagcgcgtgctggccgtgccc
ggtacgggcttcggctatccgggattcttccgcctggccttctgcgttgacgagaagatc
atccgcaggagcgtggagggatttgcgcgggccatgaaaggatga

DBGET integrated database retrieval system