KEGG   Desulfovibrio africanus: Desaf_1876Help
Entry
Desaf_1876        CDS       T01662                                 

Definition
anthranilate synthase
Orthology
K01657  
anthranilate synthase component I [EC:4.1.3.27]
Organism
daf  Desulfovibrio africanus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:daf01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:daf00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2096931..2098346)
Genome map
AA seq 471 aa AA seqDB search
MQTITLKQTGRWMPADVQTPISLYLGLVGDSPGILLESAEVDGRLGRYSLILWDFRLILA
CRGGKLAVSAPDKRLAPLAKLDGQDWVQGVKAVANALRITPPEGFADLPPATRGLYGYFG
YGLAGLFEPKLAPAVRPADAEACLALPGQVVLYDHLHHRCCYLSLDAEAKPEMNTARILR
KPAMPIVGEVTSRSGKEGYMRSVEAAKELIRQGECIQVVLSSRFEADFSGDPFVLYRRLR
QVNPSPYMFYLKLPGVILAGSSPELLVRCDDGGLETRPIAGTRPRGVSESEDAAYAVDLL
ADPKERAEHVMLVDLGRNDLGRIATPGSVSVQKFMQVERFSHVMHLTSYVGARLKPGLDA
MDVLASAFPAGTLSGAPKVRAMEIIADLEELPRGPYGGAVGWVGLTDGRVDLDTGITIRS
LWVRDGKVCYQAGAGIVYDSVPEKEWEEVGNKSRAMSKVLRGEEATDVFAD
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatcacgctgaagcagacgggccgctggatgcccgccgacgtgcagacgccc
atcagcctctatctggggctcgttggcgactcgcccggaattcttctcgaaagcgccgag
gtggacggccgcctcggacgctacagtctgattctgtgggatttccgccttatactcgcc
tgtcgtggaggcaagctggccgtatcggctcccgacaagcggctggctcccttggccaag
ctggacggccaggattgggttcagggcgtaaaggccgtggccaacgcgctacgcatcacg
ccgcccgaaggttttgccgatctgccgccggccacgcgcgggctgtacggctattttggc
tatggtctggccgggcttttcgagcccaagctcgcaccagcggtgcggccggcggatgcc
gaagcctgcctggccctgcctggccaagtggtgctctacgaccatctgcaccaccgctgc
tgctacttgagcctggatgccgaggcaaagccggagatgaacaccgcgcgcatcctgcgc
aagccggccatgcccattgtgggcgaggtcacttcgcggtccggcaaggaaggctacatg
cgctcggtggaggcggccaaggagctcatccgccagggcgaatgcatccaggtcgtgctc
tcttcgcgcttcgaggccgacttcagcggcgaccccttcgtgctctaccgccggctgcgc
caggtcaatccgtcgccatacatgttctacctgaagctgcccggcgtaatcctggccggc
tcctcgcccgaactgctggtgcgctgtgacgacggcggcctggagacgcggcccatcgcc
ggcacccggccgcgcggagtgagcgagtccgaggacgcggcctatgccgtggacctgttg
gccgaccccaaggagcgcgccgaacacgtcatgctcgtggacctgggccgcaacgacctg
ggccgcatcgccacgccgggcagcgtgagcgtgcagaaattcatgcaggtcgagcgtttc
tcccatgtcatgcacctgacctcctacgtcggggccaggctcaagccggggctggacgcc
atggacgtgctggcctcggccttcccggccgggaccctgtccggggcgcccaaggtgcgg
gccatggagatcatcgccgacctggaggagttgccgcgcggcccttatggcggggccgtg
ggctgggtcggcctgaccgacggccgggtggatctggacacgggcatcaccattcgcagc
ctgtgggtcagggacggcaaggtctgctaccaggccggcgctggcatcgtgtacgattcc
gtaccggagaaggaatgggaggaagtcggcaacaagtcgcgggccatgtccaaggtcctg
cgcggagaggaggccacggatgtttttgctgattga

DBGET integrated database retrieval system