KEGG   Desulfovibrio africanus: Desaf_1876Help
Entry
Desaf_1876        CDS       T01662                                 

Definition
(GenBank) Anthranilate synthase
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
daf  Desulfovibrio africanus
Pathway
daf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
daf01100  Metabolic pathways
daf01110  Biosynthesis of secondary metabolites
daf01130  Biosynthesis of antibiotics
daf01230  Biosynthesis of amino acids
daf02024  Quorum sensing
Module
daf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desaf_1876
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Desaf_1876
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Desaf_1876
Enzymes [BR:daf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Desaf_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: EGJ50207
UniProt: F3Z2P0
Position
complement(2096931..2098346)
Genome map
AA seq 471 aa AA seqDB search
MQTITLKQTGRWMPADVQTPISLYLGLVGDSPGILLESAEVDGRLGRYSLILWDFRLILA
CRGGKLAVSAPDKRLAPLAKLDGQDWVQGVKAVANALRITPPEGFADLPPATRGLYGYFG
YGLAGLFEPKLAPAVRPADAEACLALPGQVVLYDHLHHRCCYLSLDAEAKPEMNTARILR
KPAMPIVGEVTSRSGKEGYMRSVEAAKELIRQGECIQVVLSSRFEADFSGDPFVLYRRLR
QVNPSPYMFYLKLPGVILAGSSPELLVRCDDGGLETRPIAGTRPRGVSESEDAAYAVDLL
ADPKERAEHVMLVDLGRNDLGRIATPGSVSVQKFMQVERFSHVMHLTSYVGARLKPGLDA
MDVLASAFPAGTLSGAPKVRAMEIIADLEELPRGPYGGAVGWVGLTDGRVDLDTGITIRS
LWVRDGKVCYQAGAGIVYDSVPEKEWEEVGNKSRAMSKVLRGEEATDVFAD
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatcacgctgaagcagacgggccgctggatgcccgccgacgtgcagacgccc
atcagcctctatctggggctcgttggcgactcgcccggaattcttctcgaaagcgccgag
gtggacggccgcctcggacgctacagtctgattctgtgggatttccgccttatactcgcc
tgtcgtggaggcaagctggccgtatcggctcccgacaagcggctggctcccttggccaag
ctggacggccaggattgggttcagggcgtaaaggccgtggccaacgcgctacgcatcacg
ccgcccgaaggttttgccgatctgccgccggccacgcgcgggctgtacggctattttggc
tatggtctggccgggcttttcgagcccaagctcgcaccagcggtgcggccggcggatgcc
gaagcctgcctggccctgcctggccaagtggtgctctacgaccatctgcaccaccgctgc
tgctacttgagcctggatgccgaggcaaagccggagatgaacaccgcgcgcatcctgcgc
aagccggccatgcccattgtgggcgaggtcacttcgcggtccggcaaggaaggctacatg
cgctcggtggaggcggccaaggagctcatccgccagggcgaatgcatccaggtcgtgctc
tcttcgcgcttcgaggccgacttcagcggcgaccccttcgtgctctaccgccggctgcgc
caggtcaatccgtcgccatacatgttctacctgaagctgcccggcgtaatcctggccggc
tcctcgcccgaactgctggtgcgctgtgacgacggcggcctggagacgcggcccatcgcc
ggcacccggccgcgcggagtgagcgagtccgaggacgcggcctatgccgtggacctgttg
gccgaccccaaggagcgcgccgaacacgtcatgctcgtggacctgggccgcaacgacctg
ggccgcatcgccacgccgggcagcgtgagcgtgcagaaattcatgcaggtcgagcgtttc
tcccatgtcatgcacctgacctcctacgtcggggccaggctcaagccggggctggacgcc
atggacgtgctggcctcggccttcccggccgggaccctgtccggggcgcccaaggtgcgg
gccatggagatcatcgccgacctggaggagttgccgcgcggcccttatggcggggccgtg
ggctgggtcggcctgaccgacggccgggtggatctggacacgggcatcaccattcgcagc
ctgtgggtcagggacggcaaggtctgctaccaggccggcgctggcatcgtgtacgattcc
gtaccggagaaggaatgggaggaagtcggcaacaagtcgcgggccatgtccaaggtcctg
cgcggagaggaggccacggatgtttttgctgattga

DBGET integrated database retrieval system