KEGG   Desulfovibrio africanus: Desaf_2414Help
Entry
Desaf_2414        CDS       T01662                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
daf  Desulfovibrio africanus
Pathway
daf00010  Glycolysis / Gluconeogenesis
daf00030  Pentose phosphate pathway
daf00051  Fructose and mannose metabolism
daf00052  Galactose metabolism
daf00230  Purine metabolism
daf00500  Starch and sucrose metabolism
daf00520  Amino sugar and nucleotide sugar metabolism
daf00521  Streptomycin biosynthesis
daf01100  Metabolic pathways
daf01110  Biosynthesis of secondary metabolites
daf01120  Microbial metabolism in diverse environments
daf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaf_2414
   00030 Pentose phosphate pathway
    Desaf_2414
   00051 Fructose and mannose metabolism
    Desaf_2414
   00052 Galactose metabolism
    Desaf_2414
   00500 Starch and sucrose metabolism
    Desaf_2414
   00520 Amino sugar and nucleotide sugar metabolism
    Desaf_2414
  Nucleotide metabolism
   00230 Purine metabolism
    Desaf_2414
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desaf_2414
Enzymes [BR:daf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Desaf_2414
    5.4.2.8  phosphomannomutase
     Desaf_2414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: EGJ50738
UniProt: F3YYI4
Position
complement(2681612..2683006)
Genome map
AA seq 464 aa AA seqDB search
MKPINKEVFRAYDIRGIVDRDFDLDWVETLGRACGTWFHGHGWTKAVVGHDCRHSSPGYQ
ERLAKGLASCGLDVLLLDLVPTPAFYFAAKTLGYQAGVMVTASHNPPEFNGFKVWAGETT
AHTEQVQAIYETMASGVFVQGSGTITRRDLVPTYLDALASQARVQRPVKVVVDGGNGTGG
LITAELLRRVGCEVIELYCEPDGNFPNHHPDPVVEKYMHALQAKVLETGAACGIGLDGDD
DRIGVVDEKGRLMFGDQLLAIYARHMLRDYPGSTVIGEVKCSHLMYREIEDLGGVPLMWK
TGHSLIKAKMKETGARLAGEMSGHMFFADRYHGYDDATYAALRLVEILSEGGAPLSERLA
HWPRTYNTPEIRVDCPEEIKFAIVAKAQEHFRRTREIIDVDGARILFPDGWGLVRASNTQ
PVLVLRFEAESAERLAALRQEVEDHIQAWIQEALESVKPVTSEA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgatcaataaggaagtctttcgcgcttatgacatccgaggcatcgtggacagg
gatttcgatctcgactgggtcgagaccttgggccgagcttgcgggacatggttccatggg
cacggctggaccaaagcagttgtaggccacgattgccgccactcctctcccggctaccag
gagcgcctggccaagggtcttgcctcctgcggcctggacgtgcttctgctggatctcgta
cctaccccggccttctacttcgcggccaagaccctgggctaccaggccggagtcatggtc
acggccagccacaatccgccggaattcaacggcttcaaggtctgggccggcgagacaacc
gcccataccgagcaggtgcaggcgatctacgaaaccatggcctccggcgtgttcgtccag
ggctcgggcacgataacccgccgggacctagtgccaacctacctcgatgcactggcctct
caggcccgcgtgcagcggcccgtaaaggtagtggtggatggcggcaacggcacgggcgga
ctcataaccgccgaactgctgcgccgggtcggttgcgaggtgatcgagctgtactgcgaa
ccggacgggaactttcctaaccaccatcccgatccggttgtggaaaaatacatgcatgct
ctgcaggccaaggtcctcgaaacaggcgcggcctgcggcatcgggctggacggcgacgac
gaccgcatcggcgtggtggacgaaaaaggccggctcatgttcggagaccagctcctggca
atctacgcccgccacatgctgcgcgactaccccggttccacggtcatcggcgaggtcaaa
tgttcgcacctcatgtatcgcgaaatcgaggatcttggcggcgttccgctcatgtggaag
accggccattcgctcatcaaggccaagatgaaggaaaccggcgcgcgcctggcaggcgaa
atgagcgggcacatgttcttcgccgaccgctaccatggctatgacgacgccacctatgcg
gcgctgcgtctagtggagattctttccgaaggcggcgcgccgctttcggagaggctcgcg
cactggccgcgcacctacaatacgccggaaatccgcgtggactgccccgaggaaatcaag
ttcgccatcgtcgccaaggcccaggagcatttcaggcgcacgcgcgagatcatcgacgtg
gacggcgcgcgcattctcttccccgacggctgggggctcgtgcgcgcttccaacacccaa
cccgtgctcgtcctgcgcttcgaggccgagagcgccgagcgcctggccgcactcaggcaa
gaggtggaagaccatatccaggcctggattcaggaggccctggaatcggtaaaacccgtc
acctctgaagcctga

DBGET integrated database retrieval system