KEGG   Desulfovibrio africanus: Desaf_2414Help
Entry
Desaf_2414        CDS       T01662                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
daf  Desulfovibrio africanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaf_2414
   00030 Pentose phosphate pathway
    Desaf_2414
   00051 Fructose and mannose metabolism
    Desaf_2414
   00052 Galactose metabolism
    Desaf_2414
   00500 Starch and sucrose metabolism
    Desaf_2414
   00520 Amino sugar and nucleotide sugar metabolism
    Desaf_2414
  Nucleotide metabolism
   00230 Purine metabolism
    Desaf_2414
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desaf_2414
Enzymes [BR:daf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Desaf_2414
    5.4.2.8  phosphomannomutase
     Desaf_2414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2681612..2683006)
Genome map
AA seq 464 aa AA seqDB search
MKPINKEVFRAYDIRGIVDRDFDLDWVETLGRACGTWFHGHGWTKAVVGHDCRHSSPGYQ
ERLAKGLASCGLDVLLLDLVPTPAFYFAAKTLGYQAGVMVTASHNPPEFNGFKVWAGETT
AHTEQVQAIYETMASGVFVQGSGTITRRDLVPTYLDALASQARVQRPVKVVVDGGNGTGG
LITAELLRRVGCEVIELYCEPDGNFPNHHPDPVVEKYMHALQAKVLETGAACGIGLDGDD
DRIGVVDEKGRLMFGDQLLAIYARHMLRDYPGSTVIGEVKCSHLMYREIEDLGGVPLMWK
TGHSLIKAKMKETGARLAGEMSGHMFFADRYHGYDDATYAALRLVEILSEGGAPLSERLA
HWPRTYNTPEIRVDCPEEIKFAIVAKAQEHFRRTREIIDVDGARILFPDGWGLVRASNTQ
PVLVLRFEAESAERLAALRQEVEDHIQAWIQEALESVKPVTSEA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgatcaataaggaagtctttcgcgcttatgacatccgaggcatcgtggacagg
gatttcgatctcgactgggtcgagaccttgggccgagcttgcgggacatggttccatggg
cacggctggaccaaagcagttgtaggccacgattgccgccactcctctcccggctaccag
gagcgcctggccaagggtcttgcctcctgcggcctggacgtgcttctgctggatctcgta
cctaccccggccttctacttcgcggccaagaccctgggctaccaggccggagtcatggtc
acggccagccacaatccgccggaattcaacggcttcaaggtctgggccggcgagacaacc
gcccataccgagcaggtgcaggcgatctacgaaaccatggcctccggcgtgttcgtccag
ggctcgggcacgataacccgccgggacctagtgccaacctacctcgatgcactggcctct
caggcccgcgtgcagcggcccgtaaaggtagtggtggatggcggcaacggcacgggcgga
ctcataaccgccgaactgctgcgccgggtcggttgcgaggtgatcgagctgtactgcgaa
ccggacgggaactttcctaaccaccatcccgatccggttgtggaaaaatacatgcatgct
ctgcaggccaaggtcctcgaaacaggcgcggcctgcggcatcgggctggacggcgacgac
gaccgcatcggcgtggtggacgaaaaaggccggctcatgttcggagaccagctcctggca
atctacgcccgccacatgctgcgcgactaccccggttccacggtcatcggcgaggtcaaa
tgttcgcacctcatgtatcgcgaaatcgaggatcttggcggcgttccgctcatgtggaag
accggccattcgctcatcaaggccaagatgaaggaaaccggcgcgcgcctggcaggcgaa
atgagcgggcacatgttcttcgccgaccgctaccatggctatgacgacgccacctatgcg
gcgctgcgtctagtggagattctttccgaaggcggcgcgccgctttcggagaggctcgcg
cactggccgcgcacctacaatacgccggaaatccgcgtggactgccccgaggaaatcaag
ttcgccatcgtcgccaaggcccaggagcatttcaggcgcacgcgcgagatcatcgacgtg
gacggcgcgcgcattctcttccccgacggctgggggctcgtgcgcgcttccaacacccaa
cccgtgctcgtcctgcgcttcgaggccgagagcgccgagcgcctggccgcactcaggcaa
gaggtggaagaccatatccaggcctggattcaggaggccctggaatcggtaaaacccgtc
acctctgaagcctga

DBGET integrated database retrieval system