KEGG   Desulfovibrio africanus: Desaf_2643Help
Entry
Desaf_2643        CDS       T01662                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
daf  Desulfovibrio africanus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desaf_2643
Enzymes [BR:daf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Desaf_2643
Exosome [BR:daf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desaf_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2923648..2924619)
Genome map
AA seq 323 aa AA seqDB search
MTFFRGRRLRRTPAIRDLVRENALSPNDLIQPWFVVETDDKNFEKPIGSMPGQSQYSLHK
LVERAGWAVDKGLRSCILFGIPKVKDPQASQAWADEGIVQQAVRALKDKYPQLVVMTDVC
LCEYTSHGHCGIVRGEDILNDPTLELLAKSALSHARAGADMVAPSDMMDGRVAAIRVMLD
DNGFNDLPIMSYAVKYASAFYGPFREAAESTPQFGDRRTHQMDPANRREALREAVADLDE
GADVLMVKPAMPYLDIIRDLRENFDTPIAAYHVSGEYAMIKAAAANGWIDEKRVVMESLI
GIKRAGADLILTYYAEDALDWLK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacattcttccgaggacgccgcctgcgccgcacgccggccatccgcgatctggtgcgc
gagaacgcgctttctccaaacgacctcattcagccctggttcgtggtcgagaccgacgac
aaaaatttcgagaagcccatcggctctatgccgggacagagccagtacagcctgcacaaa
ctcgtggaacgtgcgggttgggcagtggacaagggattgcgctcctgcatcctgttcggc
atccccaaggtcaaggacccgcaggccagccaggcttgggccgacgagggcatcgtgcag
caggccgtgcgcgcgctcaaggacaagtacccgcagctcgtggtcatgaccgacgtgtgc
ctgtgcgagtacacctcccatggccattgcggcatcgtgcgcggcgaggacatcctgaac
gacccgacgctggagctcctggccaaatccgccctgtcccacgcccgcgccggcgcggac
atggtcgcgccctcggacatgatggacggccgcgtggcggccatccgcgtcatgctcgac
gacaacggcttcaacgacctgccgatcatgagctacgcggtcaaatacgcctcggccttc
tacggcccattccgcgaggcggccgaatccacgccgcagttcggcgaccgccgcacgcac
cagatggacccggccaaccgccgcgaggccctgcgcgaagccgtggccgacctggacgag
ggcgcggacgtgctcatggtcaagccggccatgccatacctggatatcatccgcgatctg
cgcgaaaacttcgacacgcccatcgcggcctaccacgtgagcggcgagtacgccatgatc
aaggccgccgcagccaacggctggatcgacgaaaagcgtgtggtcatggagtctttgatc
gggatcaagcgcgccggcgcagacctgatcctgacctactatgccgaggacgcgctggat
tggctgaagtag

DBGET integrated database retrieval system