KEGG   Desulfovibrio africanus: Desaf_2658Help
Entry
Desaf_2658        CDS       T01662                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
daf  Desulfovibrio africanus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:daf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2937881..2939152)
Genome map
AA seq 423 aa AA seqDB search
MQQYSNLSHSLQTARPGQASREYISRLPATAAPFPRRLAILGSTGSIGVSALKICAAHPD
KFQVLALAGGRNAKLLAEQAAAFRPAWLGVLDDDTAAELIDLLPNGYAPTVLVGESAYTS
IAALDWADVVLSCIVGAAGLAPTLAAVRAGKIVALANKESLVLAGGIIRQACRESGAVIL
PVDSEHNALFQAVHADGLKPVRSLILTASGGPFRGWDKERLRSVTRAQALNHPNWSMGAK
ITIDSSTLMNKGLEFIEACHLFGMAPQDVRVIVHPQSIVHSLAEFVDGSLLAHMGPPDMR
VAIAYCLGFPERLGTGLAPLDLIALGQLTFEAPDTQAFPCLRLAQEAFAAGPSHPVVLNA
ANEVAVDLFLRGRISYLDIPACIEAELSAHTSVTVDDLESILALDHEVRARTLAHWGERT
EQG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagtacagcaatctttcccattccctacaaaccgccaggcccggccaagccagt
cgggagtatatctcccgtctgcccgccactgccgcgccattcccccgtcgcttggccatt
cttggcagcacgggctcaattggcgtaagcgccttgaaaatctgcgccgcccaccccgac
aagtttcaggtgctggccctggctggaggccgcaacgccaagctcctggccgagcaagcc
gcagctttcaggccggcgtggcttggggttctcgacgacgacactgcggccgaactcatt
gatctgctgcccaacggctacgctccgacggtattggtaggagaatccgcctacacgtcc
atcgcggcactggattgggccgatgtggtgctctcctgcatcgtgggcgcggccggcctg
gcgccgaccttggcagccgtgcgcgccggcaagatcgtggccctggccaacaaggagtcc
ctggtgcttgccggcgggatcatccgccaagcctgccgcgagagcggagccgtgatcctg
cccgtggactccgagcacaacgccctgttccaggctgtgcacgccgacggcctgaagccc
gtgcgttcgctcatcctgaccgcatcgggaggcccgttccgcggctgggacaaggagcgg
ctgcgcagcgtgacacgggcgcaggccctgaaccatcccaactggagcatgggcgccaag
attaccatcgactcgtccacgctcatgaacaagggcctggagttcatagaagcctgccac
ctgttcggcatggccccgcaggacgtgcgcgtgatcgtgcacccgcagtccatcgtacac
tccctcgccgagttcgtggatggatctctgcttgcccacatgggcccgccggacatgcgc
gtggccatagcctattgcctgggcttccccgagcgtctgggcaccggccttgcgcccctg
gatctcatcgccttggggcagctcactttcgaagccccggacacccaggccttcccatgc
ctgcgcttggcccaggaagcctttgccgccggcccgagccatcccgtggtgctcaacgcc
gccaacgaagtggccgtggatctttttctgcgtgggcgtatcagctatctggacattccg
gcctgcatcgaggccgaattgtcggcccatacctccgtgaccgtggacgatttggaatcc
atcctggccctggatcatgaggtgcgcgcgcgcaccctggctcactggggcgagagaacc
gagcaaggatag

DBGET integrated database retrieval system