KEGG   Desulfovibrio africanus: Desaf_2711Help
Entry
Desaf_2711        CDS       T01662                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
daf  Desulfovibrio africanus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:daf01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:daf00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2993876..2995105)
Genome map
AA seq 409 aa AA seqDB search
MLDSLLRRLEGKRQTVIELQRRLVAVPALGPDNEGQGEWAKAQLTKAMLAEMGLGVDRDM
HAPDSRVPDGLRPNFTCVIPGKDRSKTIWVISHLDIVPPGDLSLWQGDPYVLRVEGDQLY
GRGTEDNNQAAVSSLILAQSILEERLTPPINLGMLFVADEETASKFGLEYVIKQYADYFR
PGDLFLVPDFGGPDSSMMEVAEKSIFWLKITVFGKQCHASTPEQGNNTLVAASDLVLRIR
ELYNIFDARDEMFNPPFSTFEPTKKEANVENVNTVPGKDVFYVDCRVLPCYPLAQVMDKI
RELGRQVEAKHGVRIEYQDVQREDAAPPTSPESEVVTRLAAAIRRIYDVEPKPTGIGGGT
VAAVLRRAGHPAVVWSTLNHNAHQPNEHSSITFTIGDAKVMAAMLWPEG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattcgctccttcgcaggcttgagggcaagcgccagacagtaatcgaactgcag
cgccgcctggtggccgttcccgcgctgggcccggataacgaaggccaaggggaatgggcc
aaggcccagctgaccaaggccatgctcgcggaaatgggcctgggcgtggacagggacatg
cacgctcccgattcgcgggtgccggacggcctgcgcccaaatttcacctgtgtcattccc
ggcaaggacaggagcaaaaccatttgggtcatctcgcacctggacatcgtgccgccaggc
gatctctccttgtggcagggagacccctatgtgttgcgcgtggagggcgaccaactctat
ggacgcggcaccgaggacaacaatcaggctgcggtttcctcacttattttggcccagagc
atcctggaggagcggctcacgccgcctatcaacctgggtatgctcttcgttgccgacgag
gagacagccagcaagttcggtctggaatacgtcatcaagcaatatgcggactatttccgg
cccggcgacctgttcctggtgccagacttcggcggcccggattctagcatgatggaagtg
gccgagaagagcatcttctggctcaagatcacggtgttcggcaagcagtgccatgcctcc
acgcccgagcagggcaacaacaccctggtggcggcatccgacctcgtgctgcgcatccgt
gaactgtacaatattttcgatgcgcgcgacgagatgttcaatccgcctttctccaccttc
gagcccaccaagaaggaggccaatgtggagaacgtgaacaccgtgccgggcaaggacgtt
ttctacgtggattgccgcgtgctgccctgctatcccctggcgcaggtcatggacaaaatc
cgcgagcttggccggcaggtggaggccaagcacggcgtgcgcatcgaataccaggatgtg
cagcgcgaagatgcagcgccgcccacttcgccagaaagcgaagtagtcacgcgcctggcc
gcggccatccgcaggatctacgacgtggagcccaagcccacgggtatcggaggaggcaca
gtggccgccgtgctgcgtcgcgccggccatccggccgtggtctggtccaccctgaaccac
aatgcccatcagcccaacgaacacagttccatcaccttcaccatcggtgacgccaaagtc
atggccgccatgctctggcccgagggatag

DBGET integrated database retrieval system