KEGG   Desulfovibrio africanus: Desaf_2711Help
Entry
Desaf_2711        CDS       T01662                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
daf  Desulfovibrio africanus
Pathway
daf00300  Lysine biosynthesis
daf01100  Metabolic pathways
daf01120  Microbial metabolism in diverse environments
daf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Desaf_2711
Enzymes [BR:daf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Desaf_2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: EGJ51026
UniProt: F3Z0U8
Position
complement(2993876..2995105)
Genome map
AA seq 409 aa AA seqDB search
MLDSLLRRLEGKRQTVIELQRRLVAVPALGPDNEGQGEWAKAQLTKAMLAEMGLGVDRDM
HAPDSRVPDGLRPNFTCVIPGKDRSKTIWVISHLDIVPPGDLSLWQGDPYVLRVEGDQLY
GRGTEDNNQAAVSSLILAQSILEERLTPPINLGMLFVADEETASKFGLEYVIKQYADYFR
PGDLFLVPDFGGPDSSMMEVAEKSIFWLKITVFGKQCHASTPEQGNNTLVAASDLVLRIR
ELYNIFDARDEMFNPPFSTFEPTKKEANVENVNTVPGKDVFYVDCRVLPCYPLAQVMDKI
RELGRQVEAKHGVRIEYQDVQREDAAPPTSPESEVVTRLAAAIRRIYDVEPKPTGIGGGT
VAAVLRRAGHPAVVWSTLNHNAHQPNEHSSITFTIGDAKVMAAMLWPEG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattcgctccttcgcaggcttgagggcaagcgccagacagtaatcgaactgcag
cgccgcctggtggccgttcccgcgctgggcccggataacgaaggccaaggggaatgggcc
aaggcccagctgaccaaggccatgctcgcggaaatgggcctgggcgtggacagggacatg
cacgctcccgattcgcgggtgccggacggcctgcgcccaaatttcacctgtgtcattccc
ggcaaggacaggagcaaaaccatttgggtcatctcgcacctggacatcgtgccgccaggc
gatctctccttgtggcagggagacccctatgtgttgcgcgtggagggcgaccaactctat
ggacgcggcaccgaggacaacaatcaggctgcggtttcctcacttattttggcccagagc
atcctggaggagcggctcacgccgcctatcaacctgggtatgctcttcgttgccgacgag
gagacagccagcaagttcggtctggaatacgtcatcaagcaatatgcggactatttccgg
cccggcgacctgttcctggtgccagacttcggcggcccggattctagcatgatggaagtg
gccgagaagagcatcttctggctcaagatcacggtgttcggcaagcagtgccatgcctcc
acgcccgagcagggcaacaacaccctggtggcggcatccgacctcgtgctgcgcatccgt
gaactgtacaatattttcgatgcgcgcgacgagatgttcaatccgcctttctccaccttc
gagcccaccaagaaggaggccaatgtggagaacgtgaacaccgtgccgggcaaggacgtt
ttctacgtggattgccgcgtgctgccctgctatcccctggcgcaggtcatggacaaaatc
cgcgagcttggccggcaggtggaggccaagcacggcgtgcgcatcgaataccaggatgtg
cagcgcgaagatgcagcgccgcccacttcgccagaaagcgaagtagtcacgcgcctggcc
gcggccatccgcaggatctacgacgtggagcccaagcccacgggtatcggaggaggcaca
gtggccgccgtgctgcgtcgcgccggccatccggccgtggtctggtccaccctgaaccac
aatgcccatcagcccaacgaacacagttccatcaccttcaccatcggtgacgccaaagtc
atggccgccatgctctggcccgagggatag

DBGET integrated database retrieval system