KEGG   Desulfovibrio africanus: Desaf_2714Help
Entry
Desaf_2714        CDS       T01662                                 

Definition
putative carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
daf  Desulfovibrio africanus
Brite
Enzymes [BR:daf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Desaf_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2997318..2998121
Genome map
AA seq 267 aa AA seqDB search
MDIGTREDIACLLLHGFTGEPFEMEPLLEHLLARGIHAEAPLLPGHGKGVAAFATSSFSE
WAEASEQAYLELRARFAAVAVVGLSMGGSLALRIGQRHQPAGIVTMAAPVYIYRWFPPEV
CDWRLPLVGMLRRVMPMVKTRPPSPESRAIAPWQGIGEVMCLEPLHSLMQGLKPIRRDLG
AVRAPLLVLHAPGDRIVPVGNAWDILRRVGSSRRRLEFLPIQERITSRHVLTTHRETRAQ
VCELVEEFVMSLECNSPAGFCACGQQV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggatattgggacgcgcgaggacatcgcttgtcttctgctgcacgggtttaccggcgag
ccgttcgagatggagcccctgctggagcacctgcttgccaggggcatccacgccgaagcg
ccattgctgccgggccatgggaagggggtggcggcattcgccacaagctccttctccgag
tgggccgaagcctcggaacaagcctatctggagttgcgcgcacgttttgcggccgtggct
gtggtcggcctgtccatgggcggcagtttggccctgcgcatcggacagcgccatcagccc
gccggcatcgtgaccatggcggcgcccgtctacatttaccgctggtttcctcccgaggtt
tgcgactggcgtctgcccttggtcggcatgctgcgccgcgtcatgcctatggtcaagacg
cggccgcctagtcccgaatccagggccatcgcgccctggcagggcatcggcgaggtcatg
tgcctggagcctttgcacagcctcatgcaagggctcaagcctatccgccgcgatttggga
gcggtgcgcgcccccctgctcgtgctgcatgcgcccggcgacaggatcgtgccggtgggc
aacgcctgggatatattgcgccgcgttggttcgtcacggcgcagactggagtttctgccc
atccaggagcgcatcaccagccgccacgtgctgactacacaccgggagactcgcgcgcag
gtctgcgaactggtggaggagttcgtcatgagcctggaatgtaattcacccgccggattt
tgcgcttgtggtcaacaggtctaa

DBGET integrated database retrieval system