KEGG   Desulfovibrio africanus: Desaf_2890Help
Entry
Desaf_2890        CDS       T01662                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
daf  Desulfovibrio africanus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:daf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desaf_2890
DNA repair and recombination proteins [BR:daf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Desaf_2890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3190948..3191556
Genome map
AA seq 202 aa AA seqDB search
MTNKLPRPLRDVAEQMARLPGFGPKSALRAALALLGMPREQAEGLGRAILTLREHLCFCS
RCNSISEFDPCPVCADPGRDSEQLVLVSDWDSLLALEEGGFFRGQYFVLGGLLAPLDKVN
PEQLAFDRLRDRLAESEVRELILALGTTMDAEATASYVKNMVERDFPEVRVTRLAQGIPL
GSEVRFVDKETLRQSLLHRQKL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaagcttccccggccgctacgcgacgtggccgaacagatggcgcgcctgcct
ggcttcgggcccaaatccgcgttgcgtgcggccctagcacttctgggcatgccccgagag
caggccgagggcctggggcgggccatcctgactttgcgcgaacatctgtgtttctgctcg
cgctgcaattccatcagcgagttcgacccatgtcccgtctgcgccgatccgggccgcgac
tccgagcaactcgtgctcgtgagcgattgggacagtctgctggctttggaggagggcggc
ttttttcgcgggcaatactttgttcttggcgggctgctggctccgctggacaaggtgaat
cccgagcagctggccttcgaccgcttgcgcgaccggctggccgagagtgaggtgcgcgag
ctgatcctggccctcggcacgaccatggacgccgaggccacggcctcctacgtgaagaac
atggtcgagcgcgactttccggaggtgcgcgtcacacgtctggcccagggcattcccctc
ggctcggaggtgcgcttcgtggacaaggaaactctgcgccagtcacttcttcaccggcag
aagttgtaa

DBGET integrated database retrieval system