KEGG   Desulfovibrio africanus: Desaf_2974Help
Entry
Desaf_2974        CDS       T01662                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
daf  Desulfovibrio africanus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desaf_2974
Enzymes [BR:daf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Desaf_2974
Exosome [BR:daf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desaf_2974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3280319..3282313)
Genome map
AA seq 664 aa AA seqDB search
MHSLHHDISLLTDHDIYLFKEGRHFRLWEKLGSHFMERHGERGVLFAVWAPNAQAVSVKG
DFNGWSTDEHPLRVREDGSGIWEGFITGLGQGTKYKYHIRSHFHGYRVDKADPFAVHCET
PPYTASILWDIDSGQPWTDQDWMTTRHERNGLSAPMAVYEMHLGSWQRKIEEGNRSLSYR
EIAGPLVNYLKETGFTHIELMPVQEHPFYGSWGYQSTAYFAPTSRYGTPQDFMFLVDELH
KAGIGVIVDWVPSHFPTDEHGLGYFDGTHLFEHSDPRQGFHPDWKSFIFNYDRWEVRSFL
ISSALFWLEKYHLDGLRMDAVASMLYLDYSRGDDWIPNKYGGRENLGAVEFLRSLNEAVY
RDFPDVQTIAEESTAWPMVSRPIYVGGLGFGLKWNMGWMHDTLDYFSHEAVHRKYHHNQI
TFSIWYAFTENFMLSLSHDEVVHGKGSLLGKMPGDAWQKFANLRLLFGYMWAHPGKKLLF
MGMEFGQGPEWNHESSLDWHQLELPAHQGVKNWLADLNRVYRDCPELHEVDFSPAGFRWV
DFGDAEQSVFSFLRIDSKGREMLIVLNCTPVPRQNYRLGVPRSGFWREVLNSDAAYYGGS
GWGNAGGVQATPIPSHGFFDSISVALPPLGVLFFRPEDQRPREPEHKRFVYPYPLSPEEP
ETEG
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgcactcactgcatcatgacatcagtctgctcacggaccatgatatctacctgttcaaa
gaaggtcgccacttccgattatgggagaagctcggttcgcatttcatggagcgccacggc
gaacgcggagtgctctttgcggtctgggcgcccaatgcccaggctgtgagcgtcaagggc
gacttcaacggatggagcactgacgagcaccctctgcgagtgcgcgaggatggttcgggc
atttgggagggcttcatcactggtctgggacaaggcaccaagtacaagtaccacatccgt
tcgcactttcatggctatcgcgtggacaaggccgatccgttcgccgtccactgcgaaacc
ccgccgtataccgcgtccatcctgtgggacatcgactcgggccagccctggacagaccag
gattggatgaccacgcgccacgagcgcaacggcctcagcgcacccatggccgtgtatgaa
atgcacctgggctcctggcagcgcaagatcgaagagggcaaccgctccctgagctaccgg
gagatcgccggcccgctggtcaactacctcaaggaaacgggcttcacgcacatcgagcta
atgcctgtgcaggagcatcctttctacggctcctggggctaccagagcacagcctatttc
gcaccaacctcgcgctacggcacgccacaggattttatgttcctggtggacgagctgcac
aaggccggaatcggcgtcatcgtggactgggtgccctcgcatttccccacggacgagcat
ggcctgggctacttcgacggcacgcacctcttcgagcactcggacccgcgccagggcttc
caccctgactggaaaagcttcatcttcaactacgaccgctgggaggtgcgctcgttcctc
atctcaagcgccctgttctggttggaaaaatatcatctggacggcctgcgcatggatgcc
gtggcctccatgctctacctggactactcgcgcggggacgactggattcccaacaaatac
ggaggccgggagaacctgggggccgtcgagttcctgcgttcgctcaacgaagccgtatac
cgcgacttcccggatgtgcagactatcgccgaggagtccacggcctggcccatggtctcg
cggcctatctatgtcggcgggctgggcttcggccttaagtggaacatgggctggatgcac
gataccctggattatttctctcacgaagccgtgcatcgcaaataccaccacaaccagatc
accttcagcatctggtacgccttcaccgagaatttcatgctttccctgtcccatgacgaa
gtcgtgcacggcaaaggctcgctgctcggcaagatgcctggcgacgcgtggcagaagttc
gccaacctgcgccttttgttcggctacatgtgggcccatccgggcaagaagctcctgttc
atgggcatggaattcggccagggacccgagtggaatcatgaaagcagtctggattggcat
cagctggagttgcctgcgcaccagggcgtgaagaactggcttgcggacttgaaccgggtt
taccgtgactgcccggagctgcacgaagtggacttttcacccgccggcttccgctgggtg
gatttcggcgatgccgagcagagtgttttcagcttcctgcgcatcgactccaagggccga
gaaatgctcatagtgctcaactgtacgcccgtgcctcgacagaactaccgcctgggcgtg
ccgcggagcggtttctggcgcgaggtgcttaacagcgacgcagcatactacggcggcagc
ggctggggcaacgcgggcggcgtgcaggcgacgcccatcccgtcccatgggtttttcgat
tccatttcagtggccctgccgccacttggagtgcttttcttcaggcccgaggatcagcgt
ccgcgcgaacccgagcacaagcgcttcgtgtacccctatccgctctcacccgaagaaccg
gagaccgaaggatag

DBGET integrated database retrieval system