KEGG   Desulfovibrio africanus: Desaf_3123Help
Entry
Desaf_3123        CDS       T01662                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
daf  Desulfovibrio africanus
Brite
Enzymes [BR:daf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Desaf_3123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 CMAS Methyltransf_11 GCD14 SAM_MT ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: EGJ51420
UniProt: F3Z312
Position
complement(3442412..3443056)
Genome map
AA seq 214 aa AA seqDB search
MIDPKYRRERMVREQLEARGIRDQDVLRAMRTVPRHLFVQEALASQAYDDRPQPIGHGQT
ISQPYIVAFMTELLQVKPGMKVLEIGTGSGYQAAVLSEMGATVHTIERVRELYDAARKLL
LQDLKYGRIKLRLDDGTLGWPQDAPFDRILVTAGGPEVPKPLTEQLAEGGRLLIPVGERR
RNQELVLITKEKGELREERKGGVLFVDLVGQYGW
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacccgaaatatcggcgtgagcgcatggtccgggaacagctagaggccagagga
atacgggatcaggacgtcctgcgcgccatgcgcaccgtgccccggcacctcttcgttcag
gaagccttggcctcccaggcctatgatgaccgcccacaacccattgggcatgggcagacc
atctcccagccgtacattgtggccttcatgaccgaactcctccaagtcaaaccaggcatg
aaggtgctggagatcggcacaggatcgggatatcaggccgctgtactgtctgagatgggt
gccaccgttcataccatcgagcgagtgcgcgaactatatgatgccgcccgcaagcttctt
ctccaggacctcaagtatggtcgtattaagttgagactggatgatggtacacttggctgg
ccgcaggatgcgccttttgaccgcattttggtaacagctggcggtcccgaggttcctaag
ccgcttaccgagcagctggccgaaggaggccgcctgcttatccccgtgggcgagcgtcgt
cgtaatcaggagttggtcttgatcaccaaggagaagggtgagttgcgcgaggaacgcaag
ggcggagtgctgttcgtggatctcgtgggacaatacggatggtaa

DBGET integrated database retrieval system