KEGG   Desulfovibrio africanus: Desaf_3212Help
Entry
Desaf_3212        CDS       T01662                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
daf  Desulfovibrio africanus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desaf_3212
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desaf_3212
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desaf_3212
Enzymes [BR:daf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desaf_3212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3543993..3545444
Genome map
AA seq 483 aa AA seqDB search
MATLFPLHRGRMEYFCLGCGARHGIDQLLYTCPECGGVFLLEDLDFDKLRETPGEGWREI
FDARAGEKRAFLRGIFRFYEITAPVLESEDIICLGEGNTPIVEASPALQQRLGGQRMAYK
NDGQNPSASFKDRGMACAYSYLKALIRKHKWDSVLTICASTGDTSAAAALYSAYVGGAIR
TVVLLPQGKVTPQQLAQPLGSGAVVMEIPGVFDDCMKVVEHLADNYRVALLNSKNAWRIL
GQESYAFEVAQWYDWDMAGKCVFVPIGNAGNVTAIMGGFLKLHRLGIINELPRVFGVQSH
HADPVYRYYNESDPTKRTYQPVKVTPSVAQAAMIGNPVSFPRVKHFVDQYTAIGGRDAFQ
VLQVTEQAIMEAMLLANRHGHIADTQGGECLAGLMTAMDQKLISKDELAVLDATAHMLKF
IGFQEMYFQNNFPPEYGVSPDPAMTNAPLPVLSMQDKQSLTPEEFTLKAAETVASRLGVE
RKR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctacgctatttccactgcatcgcggccgcatggaatacttctgtctgggttgcggt
gcgcgccatggaatcgaccagctcctgtacacttgccccgagtgcggcggcgtattcctg
ctggaagacctggacttcgataagctgcgcgaaactcccggcgaagggtggcgtgagata
ttcgatgcccgagcgggcgagaagcgcgccttcctgcgcggcatcttccgcttttacgag
atcacggctccggtgctcgaatccgaggacatcatctgcctaggcgagggcaacacgcct
atcgtggaggccagcccagccctgcagcaacgcctgggcggccagcgcatggcctataag
aacgacggccagaaccccagcgcctccttcaaggaccgcggcatggcctgcgcctacagc
tacctcaaggcgctcatccgcaagcacaagtgggacagcgtgctgaccatctgcgcctcc
actggcgacacctcggccgcggccgcgctctacagcgcgtatgtgggtggagcaatccgc
accgtggtgctgctgccccagggcaaggtcacaccccagcagctggcccagccgctcggc
agcggcgccgtggtcatggagattcccggcgtattcgatgactgcatgaaggtggtcgag
cacctggccgacaactaccgcgtggccctgctcaactccaagaatgcctggcgcatcctg
ggacaggaatcttacgcattcgaggttgctcagtggtacgattgggacatggccggcaag
tgcgtgttcgtgcccatcggcaatgccggtaacgtcacggccatcatgggcgggttcctc
aagcttcaccgcctgggcattataaacgagctgccgcgcgtattcggcgtacagtcgcac
catgccgacccggtctaccgctactacaacgaatccgacccgaccaagcgcacataccag
ccggtcaaggtaacgccttcggttgctcaggcagccatgataggcaatccggtttccttt
ccacgcgtgaagcacttcgtcgaccagtacacggccatcggcggccgggatgccttccag
gtgctacaggtcactgaacaagccatcatggaagccatgctgctggccaaccgccatggc
cacatcgccgacacccaaggcggcgaatgcctggccgggctcatgaccgccatggaccag
aagctcatatccaaggacgaactggccgtgctcgatgctacggcacacatgctcaagttc
atcggcttccaggaaatgtatttccagaacaacttcccgcccgagtacggcgtatcgcca
gacccggccatgaccaatgctcccctgcccgtgctgtccatgcaggacaagcaaagcctg
acgcccgaggaattcacgctcaaggccgccgagaccgtggcctcgcggcttggcgtggaa
cgcaagcgctaa

DBGET integrated database retrieval system