KEGG   Desulfovibrio africanus: Desaf_3212Help
Entry
Desaf_3212        CDS       T01662                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
daf  Desulfovibrio africanus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desaf_3212
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desaf_3212
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desaf_3212
Enzymes [BR:daf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desaf_3212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3543993..3545444
Genome map
AA seq 483 aa AA seqDB search
MATLFPLHRGRMEYFCLGCGARHGIDQLLYTCPECGGVFLLEDLDFDKLRETPGEGWREI
FDARAGEKRAFLRGIFRFYEITAPVLESEDIICLGEGNTPIVEASPALQQRLGGQRMAYK
NDGQNPSASFKDRGMACAYSYLKALIRKHKWDSVLTICASTGDTSAAAALYSAYVGGAIR
TVVLLPQGKVTPQQLAQPLGSGAVVMEIPGVFDDCMKVVEHLADNYRVALLNSKNAWRIL
GQESYAFEVAQWYDWDMAGKCVFVPIGNAGNVTAIMGGFLKLHRLGIINELPRVFGVQSH
HADPVYRYYNESDPTKRTYQPVKVTPSVAQAAMIGNPVSFPRVKHFVDQYTAIGGRDAFQ
VLQVTEQAIMEAMLLANRHGHIADTQGGECLAGLMTAMDQKLISKDELAVLDATAHMLKF
IGFQEMYFQNNFPPEYGVSPDPAMTNAPLPVLSMQDKQSLTPEEFTLKAAETVASRLGVE
RKR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctacgctatttccactgcatcgcggccgcatggaatacttctgtctgggttgcggt
gcgcgccatggaatcgaccagctcctgtacacttgccccgagtgcggcggcgtattcctg
ctggaagacctggacttcgataagctgcgcgaaactcccggcgaagggtggcgtgagata
ttcgatgcccgagcgggcgagaagcgcgccttcctgcgcggcatcttccgcttttacgag
atcacggctccggtgctcgaatccgaggacatcatctgcctaggcgagggcaacacgcct
atcgtggaggccagcccagccctgcagcaacgcctgggcggccagcgcatggcctataag
aacgacggccagaaccccagcgcctccttcaaggaccgcggcatggcctgcgcctacagc
tacctcaaggcgctcatccgcaagcacaagtgggacagcgtgctgaccatctgcgcctcc
actggcgacacctcggccgcggccgcgctctacagcgcgtatgtgggtggagcaatccgc
accgtggtgctgctgccccagggcaaggtcacaccccagcagctggcccagccgctcggc
agcggcgccgtggtcatggagattcccggcgtattcgatgactgcatgaaggtggtcgag
cacctggccgacaactaccgcgtggccctgctcaactccaagaatgcctggcgcatcctg
ggacaggaatcttacgcattcgaggttgctcagtggtacgattgggacatggccggcaag
tgcgtgttcgtgcccatcggcaatgccggtaacgtcacggccatcatgggcgggttcctc
aagcttcaccgcctgggcattataaacgagctgccgcgcgtattcggcgtacagtcgcac
catgccgacccggtctaccgctactacaacgaatccgacccgaccaagcgcacataccag
ccggtcaaggtaacgccttcggttgctcaggcagccatgataggcaatccggtttccttt
ccacgcgtgaagcacttcgtcgaccagtacacggccatcggcggccgggatgccttccag
gtgctacaggtcactgaacaagccatcatggaagccatgctgctggccaaccgccatggc
cacatcgccgacacccaaggcggcgaatgcctggccgggctcatgaccgccatggaccag
aagctcatatccaaggacgaactggccgtgctcgatgctacggcacacatgctcaagttc
atcggcttccaggaaatgtatttccagaacaacttcccgcccgagtacggcgtatcgcca
gacccggccatgaccaatgctcccctgcccgtgctgtccatgcaggacaagcaaagcctg
acgcccgaggaattcacgctcaaggccgccgagaccgtggcctcgcggcttggcgtggaa
cgcaagcgctaa

DBGET integrated database retrieval system