KEGG   Desulfovibrio africanus: Desaf_3280Help
Entry
Desaf_3280        CDS       T01662                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
daf  Desulfovibrio africanus
Pathway
daf00040  Pentose and glucuronate interconversions
daf00052  Galactose metabolism
daf00500  Starch and sucrose metabolism
daf00520  Amino sugar and nucleotide sugar metabolism
daf01100  Metabolic pathways
daf01130  Biosynthesis of antibiotics
Module
daf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:daf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desaf_3280
   00052 Galactose metabolism
    Desaf_3280
   00500 Starch and sucrose metabolism
    Desaf_3280
   00520 Amino sugar and nucleotide sugar metabolism
    Desaf_3280
Enzymes [BR:daf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Desaf_3280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: EGJ51570
UniProt: F3Z3V5
Position
complement(3612166..3613035)
Genome map
AA seq 289 aa AA seqDB search
MRITQVVVPVAGWGTRSLPATKNIPKEMLPVFNKPVVQYVVEEAMRAGLTDVVFINNQNK
KIIEDHFDYNLALEGVLERAGKYDLLKAVRDVAEMVNITSVRQKVQLGLGHAVLCARDVV
KKDPFAVMVGDDLIFGAEPGIKQVLEAARSENMAVVGVMEVPPEKVSRYGIIRAEEYAPG
RYRVRGVVEKPSPSEAPSRLAIVGRYALTPEIFEHLERTQPGHGGEIQLTDALQAMARSN
RLLAVKIRGQRFDSGDWVDYLTANIYFALQDEELRYDLVKRLQELLSCK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattacccaggtcgttgttcccgtcgccggatggggcaccaggtcgctgcccgcc
accaagaatattcccaaggagatgctcccggtcttcaacaagccagtggtgcaatacgtg
gtcgaggaggccatgcgcgccggactgaccgacgtggtcttcatcaataaccagaacaag
aagatcatcgaggatcatttcgactacaacctggccttggagggcgtgctcgaacgcgcc
ggcaagtacgacctgctcaaggccgtgcgcgacgtagccgagatggtcaacatcacctcc
gtgcgccagaaggttcaactcggcttgggccacgcggtgctctgcgcccgcgacgtggtc
aagaaggatccctttgcggtcatggtcggcgacgatctcatcttcggtgccgagcccggc
atcaagcaggtcctggaagccgcgcgtagcgaaaacatggccgtcgtgggcgtcatggaa
gtaccgcccgagaaggtttccaggtacggcatcatccgcgccgaggagtacgcgcccggg
cgctaccgtgtgcgcggcgtggtggaaaagccgtcgccttccgaagccccgtcccgtctg
gccatcgttggccgttacgccctgacgcccgagatcttcgagcatctggagcgcacgcag
cctgggcacggcggcgagattcagcttacggatgcgcttcaggccatggcccgaagcaat
cgcctgcttgcggtcaagatccgcggccagcgtttcgacagcggcgactgggtggattac
ctcaccgccaatatctatttcgcgctccaggacgaggaattgcgctacgacttggtcaag
cggcttcaggagctgctgtcctgcaaataa

DBGET integrated database retrieval system