KEGG   Desulfovibrio africanus: Desaf_3324Help
Entry
Desaf_3324        CDS       T01662                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
daf  Desulfovibrio africanus
Brite
Enzymes [BR:daf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Desaf_3324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3664421..3665203)
Genome map
AA seq 260 aa AA seqDB search
MHHAACSHCLAVEAFRTLGALGILGVVMALVPAGPGLAGAAEEPGRAGERKAMVERISEE
AKGLDFILDNGGLDQAVAEAMRRVPRHEFVPEEERERAYENAPLPIGFGQTISQPVVVAI
MTDLLDIEPGSKVLEVGTGSGYQAAVLAALGARVHSIEIIPELAEFGRENLERAGFGQVA
VHQGDGYYGLEQEAPFEAIIVTAAASHIPPPLVEQLAPGGHMAIPVGGQWFTQQLNLVEK
GPDGAVTTRQLLPVAFVPLR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatgcagcatgcagccattgccttgcggttgaggctttccggacgctgggagcg
ctcggaatcctcggggtggtcatggcgctcgtgcccgcgggccccgggctggccggagcc
gccgaagagcctgggcgggccggggagcgcaaggccatggtggaacggatcagcgaggag
gccaagggactagatttcatactggacaacggcgggttggaccaggctgtggccgaggcc
atgcgccgggtgcccaggcacgagttcgtgccggaggaggagcgcgaacgggcctacgag
aacgctccgctgcccatcggttttggacagaccatttcccagcctgtcgtcgtggcgatc
atgaccgacctcctggacatcgagcccggcagcaaggtcctggaggtcggcaccggctcc
ggctaccaggccgctgtgctcgccgccctcggggcccgcgtgcacagcatcgagatcatc
ccggaactggccgagttcggccgggagaacctggagcgggcaggcttcggccaggtcgcg
gtgcaccagggcgacggttactacggcctggagcaggaggcgcccttcgaagccattatc
gtcacggccgccgcgagccatatcccgccgccgcttgtggagcagctcgcgcccggaggc
cacatggcaatccccgtgggcggacagtggttcacgcaacagctgaacctggtggagaag
ggccctgacggcgctgtaaccacgcgccaactcctgcccgtggccttcgtgcccctgcgc
tga

DBGET integrated database retrieval system