KEGG   Desulfosporosinus acidiphilus: Desaci_0084Help
Entry
Desaci_0084       CDS       T02148                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dai00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82072..82533
Genome map
AA seq 153 aa AA seqDB search
MRAFLGLGSNLGDRAYYLGEAVSALNRSSITILSKSRVYETEPWGVLDQPPYWNQVIEVE
TSLSPLDLLHVCQEIEQRLGRVRKEHWGSRTIDIDLLIYDNVVSASKELTLPHPYLEVRE
FVMAPLREIAPNLLLPSGRPISQVFGEGKVYPL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagggcatttttgggcttgggcagtaatctgggagatcgcgcctactatctgggcgag
gctgtttcagcattaaatcgttcctcaattacaattctatcgaaatcgcgcgtctatgag
acagaaccctggggagttcttgatcagcctccgtattggaaccaagtgattgaagtggag
acttccctttccccattggacttgctccatgtctgtcaagaaatcgaacagcgattgggg
cgagtgcgtaaggaacattggggctcaagaacaattgacattgatcttcttatttatgat
aatgtggttagtgcatcaaaggaattaacactgccccatccctatctggaggttcgggag
tttgtcatggcgcccttgcgtgagatcgcgccgaacctgcttttgccttcggggcggcca
attagccaggtttttggcgaagggaaggtttaccctttataa

DBGET integrated database retrieval system