KEGG   Desulfosporosinus acidiphilus: Desaci_0610Help
Entry
Desaci_0610       CDS       T02148                                 

Definition
glycosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desaci_0610
Enzymes [BR:dai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Desaci_0610
Glycosyltransferases [BR:dai01003]
 Polysaccharide
  Storage polysaccharide
   Desaci_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
610214..611332
Genome map
AA seq 372 aa AA seqDB search
MNVLSLTNEFEEESFGGAGTAVSGILHLFNRLGVGQTVIVPRSDLTLPRWELRGLQLKVL
GLPRNSQYFGNLGMIKAETVLHEFPELNQRWDLIHCHAINFTSLAYTLSGGVIPILYSVY
SFLRKELGDRAEAELQAQFNIQEDLLLRCRRIHVISQSERNYLLDRFPRYLSKTEVVSLG
ISRPPQCWEPKTANEFLYVGRLLNYKGIEDLILAINLVRQSGRQVRLNIIGKAADSSYES
RLRSLVNSRKLGASVKFLGWLPSSEVWRSMGQAAGLVVPSRREAFGLVALEGMAIGVPVI
ASGAGGLAELVTDACGLTFEPGNIKQLANTLRKAIDHPAILRSLAIRGHEKAASLEWERL
APRYLMLLNFAK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcttatccttgaccaacgaatttgaggaagagagctttggtggggcaggtaca
gcagtcagtggtattctgcacctgtttaatcgcttaggtgtaggtcaaacggttattgtg
ccgcgcagtgatctgacgctgccgagatgggaactgcgtggattacagttgaaagtttta
ggattgcctcggaacagtcagtattttggtaacttaggtatgatcaaggcagaaacagta
cttcacgaattcccggaacttaatcaaaggtgggacttaattcattgtcatgccattaat
tttacctccctagcctataccctttccggcggcgtaataccgattctttattcagtatat
tcctttttgcgcaaggaattgggagatagagcagaggcggagctgcaagcacaatttaat
attcaggaggatcttttgctgcgctgccggcgaattcatgtgataagccaaagtgaacga
aactatttgctggatagatttcctcgatacctctctaaaactgaagtcgtatccctcggc
atttcccggccccctcaatgctgggagccaaaaacagcaaatgagtttctttatgttggc
aggttgctgaattataaagggatcgaagatttaattttggctataaatttagtaaggcag
agcgggcggcaagtccggcttaatattattggaaaagcggcggacagctcctatgaatcc
cgactaagaagccttgtcaattctagaaaacttggagcatcagtcaaattcttgggttgg
ctgccaagttcagaggtatggcgttcgatggggcaggcagcaggattagtggttcccagc
cggcgtgaagctttcgggcttgtagccttggagggcatggccatcggggttccggtgatt
gcttccggagcaggaggacttgcagaattagtcaccgatgcttgtggtttaacctttgaa
ccagggaatatcaaacagttagccaatactttgcgaaaagccattgaccatccggcaatc
ctaagaagtcttgccatcagaggccatgagaaagccgcaagtttagaatgggagcggctt
gctccgcgatatctgatgctcttaaatttcgcgaaatag

DBGET integrated database retrieval system