KEGG   Desulfosporosinus acidiphilus: Desaci_0650Help
Entry
Desaci_0650       CDS       T02148                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desaci_0650
Enzymes [BR:dai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Desaci_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660657..664145
Genome map
AA seq 1162 aa AA seqDB search
MIMFNAFHDSHDLLYREPFGAVVCGQRITFRLRTFSDVSVDHCVLRLWEMDRERTIDMSP
NTKGRQCQSADCGTASANEEVADTGIFEVEYEVPDDPGLVWYYFVIQVGTQVHYYGNNQK
GLGGEGALWEREPKSYQITVYKQMTVPDWYKRGIMYQVFVDRFFNNDPNMFVRYPRKNAL
LHARWSDQPVYIKDQLGKVTDWDFFGGTLQGVIEKLPYFKELGVSILYFNPIFDAPSNHK
YDTANYHRIDPMYGDEAVFQALIETARQLGISIILDGVFSHTGSDSIYFNKYGNYPGVGA
YQSSDSPYYNWYKFNKDNHDYKAWWGVDSLPEVNEMDHTYRRFIYGSEDSVIKKWLTLGV
AGWRLDVADELPDEFIQELRQAVKTVSPHAVLIGEVWEDASNKVSYSQQRKYFLGNELDA
TMNYPFRASFLRFILGTGDSDSLDQEVMSLYENYPRENFYAAMNLIGSHDTIRVLTLLGD
APPQQSLTDTEQRTFRLSPLAKQLAVQRLKLLSLVQMTFPGVPCIYYGDEAGMEGYADPY
NRGTYPWGQEDYRIMEWYRRILRWRQEYETLMMGDFRSFYFAPDIFGFTRSVDEEEIIIL
INRHALESKIVNLYTKLEPSPFIIDLINGETLAVEALSALPINALSGRCLLRKKSRPRNL
QLDRSCGVLLHISSLPSVWGLGDLGEEAYEFIDFLADCGQSLWQVLPLNPAGEGDCPYQS
DSALAGNPLFISIDHLIREGLLNFEETKEKYDKIRSLDPRDSFLSLAFKELKQELLREAY
RQFMNLVDAVKSSYLSQESFLEFQTRNKDWLEDYSLFKALKAYFRDVPWYDWESEIAWRD
PSKLADYARLLQDDINYIKFLQYTFSYEWGKLKAYSKEKGVRIIGDLPHFVAADSCDVWV
NRGLFVLDEHGRPLKTAGVPPDYFSKTGQLWGNPVYAWDVHAVTRYGWWKRRIQLGLEMF
DYLRFDHFRGFEAYWEVDAGEKTAETGRWIKGPGKRFLESMLEEFGRCPFIVEDLGVLTP
EVNILKQIFGFPGIKVLQFTSLQEILGNSETNFVYYTGTHDNNTLLGWYELNNLVEEENQ
LSSGVDQKTSNKQSCRKLMEEVYSSQAAWVILPMQDILGLGEEARMNVPGTIYGNWQWKM
DKNLVTDEIKTWLRTQTEKTNR
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atgataatgtttaacgcgtttcatgattcacatgatttgctttatcgggaaccttttgga
gcggtggtatgcggtcaaaggataacattccgtttgagaacgttttcagatgtttctgtt
gaccattgcgttcttcgtctttgggaaatggatagagaaagaactattgatatgtcccca
aataccaagggccgccaatgtcaatcagcggattgcgggacagcttctgcgaatgaggaa
gttgcagataccggtatctttgaggtggaatacgaagtgcccgatgatcctgggcttgtc
tggtactattttgtgattcaggttggaacccaagttcattactatggtaataatcaaaaa
ggtcttgggggagagggagcactctgggagcgagagcccaagtcctatcaaatcactgtt
tataagcagatgacagtacctgactggtataaacgagggattatgtatcaagtttttgtc
gatcgtttttttaacaatgaccctaacatgttcgttagatatccgcgcaaaaatgctttg
ctgcatgcccgatggtctgatcagccggtttatattaaagaccagctcggtaaagttaca
gactgggacttttttggcggaacattgcaaggggtcatcgaaaaattaccctactttaaa
gaattgggagtaagcattctttattttaaccctatttttgacgctccaagtaatcataaa
tatgatacggcgaactatcatcggattgatccaatgtatggagatgaggcggtatttcaa
gccttaattgagactgcccggcaattaggaatctctataatcctggatggcgtcttcagt
catacaggaagtgatagtatctattttaacaaatatggcaattacccgggggtgggtgcc
taccaatcctctgactcaccttattacaactggtataaatttaataaagacaaccatgat
tataaagcctggtggggcgttgattccctgcctgaagtcaacgaaatggaccatacctac
agaaggtttatctatggttcggaagatagtgtcattaagaagtggttaactttaggggtt
gccggatggcggttggatgttgccgatgaactacctgatgagttcattcaggagctccgc
caggcggtgaagactgttagcccccacgctgttctgatcggcgaagtgtgggaagacgct
tccaataaagtaagctatagtcaacaacgcaaatatttcttgggaaatgaactggatgcg
acgatgaactatccttttcgggctagttttctccgttttattctcggaacaggtgattcg
gattcccttgatcaagaagttatgagtttatatgaaaattatcctcgagaaaatttttat
gctgctatgaacctgatcgggagtcatgatactattcgagttttgacccttttgggagat
gctcccccgcaacagagtttaacggataccgaacagaggacctttcggctttctcctctt
gccaagcaattagctgtacaaagactaaaattattaagtttagtgcaaatgacctttccg
ggagttccttgtatttactatggagatgaagcaggtatggaggggtatgccgacccttat
aaccgggggacatatccgtggggccaggaagactaccggatcatggagtggtatcgacgc
atcctgcgctggcgtcaagaatacgagacgctgatgatgggtgatttccgatcgttctat
ttcgctccggatatttttggttttacacgttccgtggatgaagaagaaatcatcatcctt
atcaatcgtcatgctttggagtctaaaatcgtaaatctctatacaaagctagagcctagc
ccatttataattgatcttataaatggggaaacactggcggtggaagcgctaagtgccttg
cccataaatgctttgagcggaaggtgtttgttgagaaagaaaagccggcctcgtaatttg
cagcttgaccgttcatgcggtgtattattgcatatcagttcattgccttccgtttgggga
ctgggagatttaggggaagaggcttatgaatttatagatttcttggctgactgcggtcaa
tctttgtggcaggtcttacccttgaatcctgccggagaaggggattgcccttatcaaagt
gattcagcgcttgccggaaatccgctatttatcagtattgatcatttaatcagggaagga
ttattaaattttgaggaaactaaagaaaaatacgataagattcggagccttgacccgaga
gacagcttcttatctcttgcttttaaagaattaaaacaggaattgcttcgtgaagcctac
cggcaatttatgaatcttgttgatgctgtaaaatcatcgtatctatcacaggaaagcttt
ttggaatttcaaaccagaaacaaagattggctggaagattattcactcttcaaggcctta
aaggcatattttagggatgttccctggtatgattgggaatccgaaattgcttggcgtgat
ccaagtaagttagccgattatgctcggcttttgcaagatgatattaattatataaagttc
ttacaatatactttttcctacgaatggggtaaactcaaggcctattccaaggaaaaagga
gttcgaatcattggggatttaccccattttgttgccgccgacagctgtgacgtctgggta
aatcgcggtttgtttgttctggatgagcatggccgacctcttaaaactgcaggggtaccc
cctgattatttcagcaagacaggtcagttatggggaaaccctgtttatgcttgggacgtt
catgctgttactcgctatggttggtggaaaagacggattcagctcggcttggaaatgttt
gattacctgcgatttgaccatttccggggttttgaagcctactgggaagttgatgctgga
gaaaagacggctgaaacgggtcgctggattaaaggacctgggaaaaggttcttagaaagt
atgttagaagagtttggacgatgcccttttattgttgaggacttgggggttttaactccg
gaagttaacatcttaaaacaaattttcggttttccgggtataaaggtcctgcaatttact
tcactacaagagatattagggaattctgagaccaattttgtctattatacaggaacccat
gataacaacactttattaggttggtatgaattaaataatttggtggaagaggaaaatcag
ctcagcagtggtgttgaccaaaaaacatcgaataaacaatcatgccgtaaattgatggaa
gaagtgtattccagtcaagcggcgtgggtaatcctaccgatgcaagatattttaggttta
ggcgaggaagcaagaatgaatgtacctgggactatttatgggaattggcagtggaagatg
gataaaaatttagttacggatgaaataaaaacttggctgcgaacccaaaccgagaaaaca
aataggtga

DBGET integrated database retrieval system