KEGG   Desulfosporosinus acidiphilus: Desaci_0850Help
Entry
Desaci_0850       CDS       T02148                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dai01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dai00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899499..900287
Genome map
AA seq 262 aa AA seqDB search
MILEKIAKRTVERVAELKREKSEEQVISEAKALDSDTAFPFEEALRAEGLSFICEVKKAS
PSKGIIAQDFPYLQIAKDYEAAGAAAISVLTEPYWFQGQDCFLTEIRQDVGIPLLRKDFI
VDSYQIYEAKIIGASAILLICTLLDTDTLKRYLEIAQSLGLSALVEAHTEEEVKSALKAG
ARVIGVNNRNLQTFEVDITTSIRLRKLVPKDFLFVSESGINSPEDVAVLKENKTDAVLIG
ESLMRSDRKKEQLAFLRGDNQQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgatattagagaaaatagcgaagcgaaccgttgagcgcgtggcggaactgaaacgagag
aaatcggaagagcaagtaatttcagaagctaaggccttagattctgatacagcgtttccc
tttgaagaggctctcagggcagagggtttatcctttatctgtgaggtaaaaaaagcgtct
ccttccaagggaattattgctcaagattttccctatttacagattgccaaggactatgag
gcggcaggagctgcggcgatttctgtgctgacagagccctattggtttcaaggacaagac
tgcttccttacggagatccgccaagacgttggcatccctcttctgcgcaaagactttatc
gtggacagttatcagatttacgaggctaagatcattggagcttcagccattttgcttatt
tgtacgctgctcgatacggatactctgaaacgctatctggaaattgctcaaagtttgggg
ctgagcgccctcgtggaagcccatacggaggaagaagttaaatcagctcttaaggcaggg
gccagagtgatcggggtcaataaccgcaaccttcagacctttgaagttgatataaccact
agtatcagactgcgcaaattagtgccgaaagatttcttatttgtctcggaaagcggcatt
aattcaccggaggacgtggcggtcttgaaggaaaataagacagatgctgttctgatcggc
gaaagtttaatgcgcagtgatcgaaaaaaggaacagcttgcctttctgcgaggggataat
cagcagtga

DBGET integrated database retrieval system