KEGG   Desulfosporosinus acidiphilus: Desaci_0850Help
Entry
Desaci_0850       CDS       T02148                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dai01100  Metabolic pathways
dai01110  Biosynthesis of secondary metabolites
dai01130  Biosynthesis of antibiotics
dai01230  Biosynthesis of amino acids
Module
dai_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desaci_0850
Enzymes [BR:dai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Desaci_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFM39906
UniProt: I4D282
Position
899499..900287
Genome map
AA seq 262 aa AA seqDB search
MILEKIAKRTVERVAELKREKSEEQVISEAKALDSDTAFPFEEALRAEGLSFICEVKKAS
PSKGIIAQDFPYLQIAKDYEAAGAAAISVLTEPYWFQGQDCFLTEIRQDVGIPLLRKDFI
VDSYQIYEAKIIGASAILLICTLLDTDTLKRYLEIAQSLGLSALVEAHTEEEVKSALKAG
ARVIGVNNRNLQTFEVDITTSIRLRKLVPKDFLFVSESGINSPEDVAVLKENKTDAVLIG
ESLMRSDRKKEQLAFLRGDNQQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgatattagagaaaatagcgaagcgaaccgttgagcgcgtggcggaactgaaacgagag
aaatcggaagagcaagtaatttcagaagctaaggccttagattctgatacagcgtttccc
tttgaagaggctctcagggcagagggtttatcctttatctgtgaggtaaaaaaagcgtct
ccttccaagggaattattgctcaagattttccctatttacagattgccaaggactatgag
gcggcaggagctgcggcgatttctgtgctgacagagccctattggtttcaaggacaagac
tgcttccttacggagatccgccaagacgttggcatccctcttctgcgcaaagactttatc
gtggacagttatcagatttacgaggctaagatcattggagcttcagccattttgcttatt
tgtacgctgctcgatacggatactctgaaacgctatctggaaattgctcaaagtttgggg
ctgagcgccctcgtggaagcccatacggaggaagaagttaaatcagctcttaaggcaggg
gccagagtgatcggggtcaataaccgcaaccttcagacctttgaagttgatataaccact
agtatcagactgcgcaaattagtgccgaaagatttcttatttgtctcggaaagcggcatt
aattcaccggaggacgtggcggtcttgaaggaaaataagacagatgctgttctgatcggc
gaaagtttaatgcgcagtgatcgaaaaaaggaacagcttgcctttctgcgaggggataat
cagcagtga

DBGET integrated database retrieval system