KEGG   Desulfosporosinus acidiphilus: Desaci_0852Help
Entry
Desaci_0852       CDS       T02148                                 

Definition
tryptophan synthase, beta subunit
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desaci_0852
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desaci_0852
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desaci_0852
Enzymes [BR:dai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desaci_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
900873..902057
Genome map
AA seq 394 aa AA seqDB search
MSKGRYGIHGGQYIPETLMNEIINLEKSYEHFKDDPEFKAELKKLLNEYAGRPSLLYYAG
KMSKDLGGAKIYLKREDLNHTGSHKINNVLGQALMAKKMGKTRVIAETGAGQHGVATATA
AALLGLECEIFMGKEDTDRQALNVYRMELLGAKVHAVTSGTMTLKDAVNETMREWTSRIH
DTHYVLGSVMGPHPFPMIVRDFQSVISEEAREQILELEGKLPDVVMACVGGGSNAMGMFY
NFIGDQSVKLIGCEAAGHGIDTEKHAATIAKGKLGVFHGMKSYFCQDEHGQIAPVYSISA
GLDYPGIGPEHANLHDSGRAEYVPITDDEAVEAFEYLARTEGIICAIESAHAVAHAKKIA
GNLSKDQIIIICLSGRGDKDVAAIARYKGVRIYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagggcagatacggcattcatgggggtcaatatatcccggaaaccttgatgaac
gaaattattaatctggaaaaatcttacgaacactttaaagatgaccccgagttcaaggcc
gagcttaagaagttgctgaacgagtatgcgggaaggccatctctgctctactatgccggg
aaaatgagcaaggatttagggggcgcgaaaatctatttgaaacgtgaagacctgaatcat
accggttcccacaaaatcaataatgttctggggcaggcgttaatggctaagaaaatgggc
aaaacacgcgttatcgctgaaacgggcgccggtcagcacggtgtcgcaactgcaacggcg
gccgccttgctcggcttggaatgtgagatttttatgggtaaggaagacacagacaggcag
gctcttaacgtttaccggatggagcttttaggcgctaaagttcatgctgtgaccagcggc
actatgactttaaaggatgcggttaacgaaaccatgcgcgagtggacgtcccgtattcac
gatacccactatgttctaggctctgtcatggggccccaccccttccccatgatcgttcgt
gattttcaaagcgtgatcagtgaggaagcaagagaacagattctggaacttgagggcaag
ctgcctgatgtggtgatggcttgtgttggcggcggcagtaatgccatggggatgttctat
aattttatcggtgaccaaagcgtaaaattaattggctgtgaagcggcgggacatggaatt
gataccgagaagcatgctgctaccatcgccaaaggaaaattaggggtctttcatggcatg
aagtcctacttctgtcaggatgaacatggacaaattgccccggtctattcaatatctgca
ggtctcgactatccgggaatagggcctgaacatgccaatcttcacgattcaggcagggcg
gaatatgtgcctattactgatgacgaggcggtagaagcttttgagtatcttgccagaaca
gaaggaattatttgtgcaattgaaagtgcccatgcggtggctcatgccaagaaaattgcc
ggaaatttgagcaaggatcaaatcatcatcatctgtttgtcaggacggggagataaagat
gttgccgccattgcgcgctataagggggtaagaatttatgagtaa

DBGET integrated database retrieval system