KEGG   Desulfosporosinus acidiphilus: Desaci_0852Help
Entry
Desaci_0852       CDS       T02148                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desaci_0852
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desaci_0852
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desaci_0852
Enzymes [BR:dai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desaci_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
900873..902057
Genome map
AA seq 394 aa AA seqDB search
MSKGRYGIHGGQYIPETLMNEIINLEKSYEHFKDDPEFKAELKKLLNEYAGRPSLLYYAG
KMSKDLGGAKIYLKREDLNHTGSHKINNVLGQALMAKKMGKTRVIAETGAGQHGVATATA
AALLGLECEIFMGKEDTDRQALNVYRMELLGAKVHAVTSGTMTLKDAVNETMREWTSRIH
DTHYVLGSVMGPHPFPMIVRDFQSVISEEAREQILELEGKLPDVVMACVGGGSNAMGMFY
NFIGDQSVKLIGCEAAGHGIDTEKHAATIAKGKLGVFHGMKSYFCQDEHGQIAPVYSISA
GLDYPGIGPEHANLHDSGRAEYVPITDDEAVEAFEYLARTEGIICAIESAHAVAHAKKIA
GNLSKDQIIIICLSGRGDKDVAAIARYKGVRIYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagggcagatacggcattcatgggggtcaatatatcccggaaaccttgatgaac
gaaattattaatctggaaaaatcttacgaacactttaaagatgaccccgagttcaaggcc
gagcttaagaagttgctgaacgagtatgcgggaaggccatctctgctctactatgccggg
aaaatgagcaaggatttagggggcgcgaaaatctatttgaaacgtgaagacctgaatcat
accggttcccacaaaatcaataatgttctggggcaggcgttaatggctaagaaaatgggc
aaaacacgcgttatcgctgaaacgggcgccggtcagcacggtgtcgcaactgcaacggcg
gccgccttgctcggcttggaatgtgagatttttatgggtaaggaagacacagacaggcag
gctcttaacgtttaccggatggagcttttaggcgctaaagttcatgctgtgaccagcggc
actatgactttaaaggatgcggttaacgaaaccatgcgcgagtggacgtcccgtattcac
gatacccactatgttctaggctctgtcatggggccccaccccttccccatgatcgttcgt
gattttcaaagcgtgatcagtgaggaagcaagagaacagattctggaacttgagggcaag
ctgcctgatgtggtgatggcttgtgttggcggcggcagtaatgccatggggatgttctat
aattttatcggtgaccaaagcgtaaaattaattggctgtgaagcggcgggacatggaatt
gataccgagaagcatgctgctaccatcgccaaaggaaaattaggggtctttcatggcatg
aagtcctacttctgtcaggatgaacatggacaaattgccccggtctattcaatatctgca
ggtctcgactatccgggaatagggcctgaacatgccaatcttcacgattcaggcagggcg
gaatatgtgcctattactgatgacgaggcggtagaagcttttgagtatcttgccagaaca
gaaggaattatttgtgcaattgaaagtgcccatgcggtggctcatgccaagaaaattgcc
ggaaatttgagcaaggatcaaatcatcatcatctgtttgtcaggacggggagataaagat
gttgccgccattgcgcgctataagggggtaagaatttatgagtaa

DBGET integrated database retrieval system