KEGG   Desulfosporosinus acidiphilus: Desaci_0853Help
Entry
Desaci_0853       CDS       T02148                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desaci_0853
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desaci_0853
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desaci_0853
Enzymes [BR:dai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desaci_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
902050..902829
Genome map
AA seq 259 aa AA seqDB search
MSNIAEAFKNGKAFIGFVTGGDPSLEKSEEYILEMVRGGADLVEIGIPFSDPIAEGPVIQ
EANIRALAAGATVDKIFNLVVSVRQKTKVPLVFLTYLNPVFNYGYSRFFQRCSEAGVDGI
IIPDLPYEEKGELTEAAAGYGVDVISLIAPTSEQRIKQIAREATGFVYVVSSMGVTGMRS
EIKTDLHSIIEVVKESSSVPTAVGFGINTPKQAGGIAKIADGVIVGSAIVKIVEKYGEGA
GPYIYDYVKSMKDAVRSAV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatcgcagaggcctttaaaaacggaaaagcctttatcggatttgtcaccggc
ggagacccttctttagagaagagtgaagagtatattttagaaatggttcggggcggtgct
gatttagtggaaatcggtattcccttttctgatcccattgccgagggaccggttattcaa
gaggcaaatattcgcgctcttgcagcaggggctacggtagacaaaatttttaatctggtg
gtttctgtgcgccaaaagacaaaggtgcctcttgtttttctaacctatttaaatcccgtc
tttaattatgggtactcacgcttttttcaacggtgttctgaggcgggagtcgacggtatc
atcattcctgatctgccctatgaagaaaagggtgaactgactgaagccgctgcaggctat
ggagttgatgttatttctctgattgcccccacctcagaacaacggattaaacagatagcc
cgggaagcgacaggcttcgtctatgtggtatcttccatgggtgtaacgggaatgagaagc
gaaattaaaacagatttgcattcaatcatagaggttgtaaaggaatcgagttcagttcct
acggcagttggctttggcatcaatacaccaaaacaagcagggggaattgctaaaattgcc
gatggcgtgattgtgggcagcgcaattgttaaaatagttgagaagtatggtgaaggggcc
ggcccttatatttatgactatgttaagagcatgaaagatgctgtgagaagtgctgtttaa

DBGET integrated database retrieval system