KEGG   Desulfosporosinus acidiphilus: Desaci_0927Help
Entry
Desaci_0927       CDS       T02148                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaci_0927
   00030 Pentose phosphate pathway
    Desaci_0927
   00051 Fructose and mannose metabolism
    Desaci_0927
   00052 Galactose metabolism
    Desaci_0927
  Energy metabolism
   00680 Methane metabolism
    Desaci_0927
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desaci_0927
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Desaci_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
976125..977204
Genome map
AA seq 359 aa AA seqDB search
MNKLAVLTGGGDCPGLNAVIRAVVRSANQYGLEVLGIRDGFHGAVEGDFVPLSLADVSGI
LPRGGTILGTTNRDNPFQYMTKVNGVSQPLDRSEDVLRNLKGAGVDALLAIGGDGSLNIS
LKFADKGFPVIGIPKTIDNDLMATDQTFGFQTAVETAQEALDRLHTTAESHHRVMILEVM
GRYAGWIALYAGVAGGADVILIPEIPYNLARIAYSVQQRAKQGKKFSIIVVAEGAKPSGG
EMVVERLFPGRTDPVKLGGIGVKIGEDLEKHFGLETRVTVLGHLQRGGSPNSYDRVLATR
YGVAAVDAALEGKFGIMVALQGREIVHVPLHQAVDQLKLVPLNDPILIAARAMGIEMGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttgcagttctcacaggcggaggggattgcccggggttaaacgcggtaatt
cgtgccgttgtcagaagcgcaaaccagtatggccttgaagttttgggaattagagacggc
tttcacggagcagtggaaggtgattttgttcccttgagtttggccgatgtttcaggaatt
ctgccgcggggaggcacgattcttggcacgacgaaccgggataatccctttcagtatatg
actaaagtcaatggggtaagtcagccccttgatcgttccgaggatgttctcagaaatctc
aagggtgccggtgtcgatgccttattagccatcggtggagatggaagtttgaatatctcc
ttgaaatttgcggacaaggggtttcccgttattggaatccctaaaaccattgataatgat
ctcatggctacagatcaaaccttcggctttcagacggctgtagaaacggctcaggaagcc
ttagaccgccttcataccactgcagaatcccatcatagggttatgattcttgaagttatg
ggacgttacgccggatggattgccctttacgcaggagttgcaggaggtgctgatgtcatt
ttgattccggagattccctataatcttgccagaatcgcctattctgttcagcagcgggcc
aaacaaggaaagaaatttagtattattgttgtggctgaaggggcaaaaccatccggcggt
gaaatggtcgttgaacgattgtttccaggacgtactgatccggttaaattagggggaatt
ggcgttaaaataggtgaggatttggaaaagcattttggtttagaaacccgagtaacggtg
cttgggcatcttcagcggggaggttcccccaattcttatgacagggtattagctacacgc
tatggtgtagccgcggtggatgctgccctggagggtaaattcgggataatggttgctctt
cagggaagggaaattgtacacgtgccgctgcatcaagcggtagaccaattaaagcttgta
cctcttaatgatcctatcctgatagcagcgcgcgctatgggaattgaaatgggagactaa

DBGET integrated database retrieval system