KEGG   Desulfosporosinus acidiphilus: Desaci_0927Help
Entry
Desaci_0927       CDS       T02148                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desaci_0927
   01230 Biosynthesis of amino acids
    Desaci_0927
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaci_0927
   00030 Pentose phosphate pathway
    Desaci_0927
   00051 Fructose and mannose metabolism
    Desaci_0927
   00052 Galactose metabolism
    Desaci_0927
  Energy metabolism
   00680 Methane metabolism
    Desaci_0927
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desaci_0927
Protein phosphatases and associated proteins [BR:dai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desaci_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
976125..977204
Genome map
AA seq 359 aa AA seqDB search
MNKLAVLTGGGDCPGLNAVIRAVVRSANQYGLEVLGIRDGFHGAVEGDFVPLSLADVSGI
LPRGGTILGTTNRDNPFQYMTKVNGVSQPLDRSEDVLRNLKGAGVDALLAIGGDGSLNIS
LKFADKGFPVIGIPKTIDNDLMATDQTFGFQTAVETAQEALDRLHTTAESHHRVMILEVM
GRYAGWIALYAGVAGGADVILIPEIPYNLARIAYSVQQRAKQGKKFSIIVVAEGAKPSGG
EMVVERLFPGRTDPVKLGGIGVKIGEDLEKHFGLETRVTVLGHLQRGGSPNSYDRVLATR
YGVAAVDAALEGKFGIMVALQGREIVHVPLHQAVDQLKLVPLNDPILIAARAMGIEMGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttgcagttctcacaggcggaggggattgcccggggttaaacgcggtaatt
cgtgccgttgtcagaagcgcaaaccagtatggccttgaagttttgggaattagagacggc
tttcacggagcagtggaaggtgattttgttcccttgagtttggccgatgtttcaggaatt
ctgccgcggggaggcacgattcttggcacgacgaaccgggataatccctttcagtatatg
actaaagtcaatggggtaagtcagccccttgatcgttccgaggatgttctcagaaatctc
aagggtgccggtgtcgatgccttattagccatcggtggagatggaagtttgaatatctcc
ttgaaatttgcggacaaggggtttcccgttattggaatccctaaaaccattgataatgat
ctcatggctacagatcaaaccttcggctttcagacggctgtagaaacggctcaggaagcc
ttagaccgccttcataccactgcagaatcccatcatagggttatgattcttgaagttatg
ggacgttacgccggatggattgccctttacgcaggagttgcaggaggtgctgatgtcatt
ttgattccggagattccctataatcttgccagaatcgcctattctgttcagcagcgggcc
aaacaaggaaagaaatttagtattattgttgtggctgaaggggcaaaaccatccggcggt
gaaatggtcgttgaacgattgtttccaggacgtactgatccggttaaattagggggaatt
ggcgttaaaataggtgaggatttggaaaagcattttggtttagaaacccgagtaacggtg
cttgggcatcttcagcggggaggttcccccaattcttatgacagggtattagctacacgc
tatggtgtagccgcggtggatgctgccctggagggtaaattcgggataatggttgctctt
cagggaagggaaattgtacacgtgccgctgcatcaagcggtagaccaattaaagcttgta
cctcttaatgatcctatcctgatagcagcgcgcgctatgggaattgaaatgggagactaa

DBGET integrated database retrieval system