KEGG   Desulfosporosinus acidiphilus: Desaci_0984Help
Entry
Desaci_0984       CDS       T02148                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desaci_0984
Enzymes [BR:dai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Desaci_0984
Exosome [BR:dai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desaci_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1038870..1040846
Genome map
AA seq 658 aa AA seqDB search
MENLPFLNIEEIYLFNRGELYNAYTKFGVHIIEQKGKTGTFFVVWVPGAKAVCVVGDFNL
WQSKRDAMLETGITGVWTLFIPKRLKGLYKFEIVTPNGDLFLKSDPFAFYSEHRPLTASR
IYSLEGYPWQDQAWISQREKSCPQEKPLLIYEVHLGSWRRKTDGSFFQWADLTEELLCYV
LEMGYTHIELMPLMEHPYDGSWGYQATGYYSCTSRYGTPHDFMYFIDCCHQAGIGVILDW
VPGHFCKDSHGLGKFNGSSLYEKDEHGKWGTYNFNFSKPEVWSFLISNAVFWLEKFHLDG
LRVDGVSSMLYLDFEKPDKGWERNSNGGRENLEAIAFMQRLNEVVFRDFPGILMIAEEAT
DWPLVTYPTYVNGLGYNFKWNMGWMNDTLRYMQQDFFCRKDCHNLLNFSLTYAFSENFVL
PLSHDEVVHGKQSLLNKMPGDYWQKFAGLRNLLGYQMGHPGKKLMFMGGEIAQFIEWRYD
AELDWLLLDYEMHKKFQAYVKELNKLYQREKAFWENEREWSGFEWIDADNKNQSILAFCR
RGKNPKDLLIIVINFQPVSYRDFRIGIPQRGIYQELFNSDQDSFGGSNCLNKKPIASEKV
PWHGRAVSLRIKVPPLATVIFKPQYKYKLRRGGVSCLRARKVLNWHTLQKSANQKVLP
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttgccttttctaaatatagaagaaatatacctgtttaacaggggagaactt
tacaacgcttatacaaagtttggggttcatatcatcgaacagaaggggaagacgggaacc
ttctttgtggtttgggtaccgggggctaaagcggtctgcgttgtaggagattttaacctt
tggcagtcaaaacgggatgccatgttggaaaccggaattacaggcgtatggactcttttt
attcctaagcgactcaagggattatataagtttgaaatcgtgaccccaaatggtgattta
tttctcaaatcagatccttttgccttctattctgagcataggccgttaacggcgtctcgg
atttactccctggagggatatccttggcaggatcaagcctggatttcgcaacgggaaaaa
agttgcccccaagaaaaaccattgcttatctatgaagttcatttaggatcttggcgccga
aaaacagatggaagtttttttcagtgggcagacttgacggaagaattgttgtgctacgtt
ctggagatgggctatacccatattgaacttatgcctctgatggagcatccttacgacggt
tcttggggctatcaggcaaccggctattattcctgtacaagccgctatggaactcctcat
gattttatgtattttattgattgttgtcatcaagcagggattggggtcattttggactgg
gttcccggacatttttgcaaggatagtcatggcttgggaaagttcaatgggtcctcgctt
tatgagaaagatgaacatggaaaatggggaacgtataacttcaatttttctaaacccgaa
gtctggagttttcttatctccaatgcagttttttggttggaaaaattccaccttgacggt
cttcgtgtggatggcgtcagcagcatgctttatcttgactttgaaaagccggataaaggt
tgggaacgcaatagcaatggagggagagaaaacctggaagccattgcctttatgcaaaga
ttaaatgaagttgtgtttcgggatttccccggaatccttatgattgccgaagaagcgacg
gattggcctttagtaacttatcctacctatgtcaatggtttaggctataacttcaaatgg
aatatggggtggatgaacgataccctgcgttatatgcagcaagattttttctgccggaaa
gattgccataacctcttgaatttttccttaacctacgccttttcggagaattttgtcttg
cccctttctcatgacgaagtagttcacgggaaacagtctcttctcaataaaatgcctggg
gactattggcaaaaatttgccggtttaagaaatttgctgggataccaaatggggcaccct
ggaaaaaagttaatgtttatggggggtgagatagcccagttcattgaatggcgttatgat
gcggaactagattggctgcttttagattacgagatgcacaaaaagtttcaggcctatgtt
aaagagctaaataaactttatcagcgggaaaaggctttctgggaaaatgagcgggaatgg
tcgggttttgagtggattgatgcggataacaagaaccaaagcattttggccttctgtcgc
cgagggaagaatcctaaggatcttcttattatagtgatcaattttcagccggttagttat
agggattttcgtataggaattccccaaagaggaatctatcaggaacttttcaattcagat
caggatagctttggaggttccaactgtctgaataaaaaacctattgcctcagagaaggtg
ccgtggcatggtcgggctgtttctttaagaataaaagttcctccgttggcaaccgtcata
ttcaaacctcaatataaatacaaattaaggcgggggggcgtttcatgtttgcgagcaagg
aaagttttaaactggcataccttacaaaaatcagcgaatcagaaggtattaccctag

DBGET integrated database retrieval system