KEGG   Desulfosporosinus acidiphilus: Desaci_1033Help
Entry
Desaci_1033       CDS       T02148                                 

Definition
ROK family protein, putative glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desaci_1033
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desaci_1033
   00052 Galactose metabolism
    Desaci_1033
   00500 Starch and sucrose metabolism
    Desaci_1033
   00520 Amino sugar and nucleotide sugar metabolism
    Desaci_1033
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Desaci_1033
   00524 Butirosin and neomycin biosynthesis
    Desaci_1033
Enzymes [BR:dai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Desaci_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1090957..1091928
Genome map
AA seq 323 aa AA seqDB search
MKSVIMGIDLGGTSIKLGLVNISGQIVQSLEWPTPKNKSYHEVIAAFERMSEQLLRESSY
SWRDILGVGIGIPGFLDFSTGSVFEVVNLGWHQVPLKEELERIWDVPVLLENDANAAALG
EMWTGAGKGASHIICLTIGTGIGGGVIINGDIYHGANGSAGEIGHITVKEQGGRPCNCGK
KGCLETEASATAIVLKTLEQVKGASGLLKEEYAKQGNSITAKSVVELAKLGDPTCQTIIA
DAGTVLGKALANMCYLLNPELIVIGGGISYAGEILFKPLTESFRNFALPRVRENTSIVQA
KLGNQAGIVGAASLIHHYDLLES
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgtgattatggggattgatttgggcggaacttcaattaagttagggctagtc
aatatctcaggacaaattgtccaaagtttagaatggcctactcccaaaaataagagctat
catgaagtgatcgcagcttttgaacggatgtctgaacaactcttacgagaaagcagctat
agttggcgagacatcttgggcgtaggcataggcataccaggttttctggatttttccaca
ggttctgtttttgaggttgttaatcttggttggcatcaggtgcctttaaaagaagaattg
gaacggatatgggatgtccccgtactgctggaaaatgacgctaatgcagcggctttggga
gaaatgtggactggggccggcaaaggggcttcgcatataatttgtttaacaataggtact
ggaatcggcgggggcgttataattaatggcgacatttatcacggagctaacggaagcgcg
ggagagattggccatattactgtaaaagaacagggcgggagaccctgtaattgcggaaaa
aagggctgcttggaaactgaagcttccgccacagctatcgttctgaaaaccttggaacag
gtgaagggagcttcagggctcttaaaagaagaatatgccaagcaagggaatagcattacc
gcaaaatcagttgtagaacttgctaagctgggagacccaacatgtcagacaatcattgcg
gatgctggaacagttttggggaaggctttggccaatatgtgttatttgcttaatcctgag
ttgattgttattggcgggggaatttcctacgctggagaaattctgtttaagcccctaacg
gaatcctttcgcaactttgccttaccaagagttcgggaaaacacctctattgtacaggct
aaattaggaaatcaggccgggattgttggtgccgcctcattgatccatcattatgatcta
ctagaatcatga

DBGET integrated database retrieval system