KEGG   Desulfosporosinus acidiphilus: Desaci_1034Help
Entry
Desaci_1034       CDS       T02148                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dai00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dai00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1092212..1093534
Genome map
AA seq 440 aa AA seqDB search
MSEIFKGIPRIHYEGPDSNNPLAFKYYNPTEILGDKTMEEHLRFSAAFWHTFNAAGADPF
GDGTISRPWDKYVDPMDKAKSRMTGAFEFFEKLGVPFFCFHDRDIAPEGENLSQTNRNFD
VIALYVKELMQTSHVKLLWGTANLFSHPRYVHGAATSSNADVFAYAAAQVKKAMEVTKEL
DGQNYVFWGGREGYETLLNTDMGLELDNLARFFHMAVDYAKKIGFTGQLLIEPKPKEPTK
HQYDFDVASVLAFLRKYGLEKDFKVNIEANHATLAGHTFQHELHYARINGSLGSVDANQG
DELLGWDTDQFPTNLYTTTLAMYEILKNGGLHKGGLNFDAKVRRASFTAENIFQAHIAGM
DAFALGLKAAYKLLKNRALENVIEERYCSYTYGIGQKICEGRIGFSELEEYALANSVKNQ
SGCQEVLESILNRYIIQAQN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaattttcaaaggaattcctcgaattcattatgaaggacctgactctaataac
cccttagcgttcaagtactataacccaactgaaatacttggcgataagacaatggaagaa
catttgcgcttttcagcagccttttggcatacgtttaatgctgccggagctgatcccttt
ggtgatggcactatttctcgcccctgggataaatacgttgaccccatggataaagcaaaa
tcaagaatgacaggtgcttttgaattctttgaaaaattaggtgtgccttttttctgcttt
catgacagggatatagcacccgagggggagaatttgtcccagaccaatcggaattttgat
gtaattgccttatatgtaaaagaattaatgcagacttcccatgttaaacttctttggggt
actgctaaccttttcagccatccgcgctatgtgcacggtgcggcaacgtcatccaatgct
gatgtttttgcttacgcagcagcccaggttaagaaagcgatggaagtaactaaagaatta
gacggtcagaactatgtattttggggtggacgtgagggctatgagaccttgctcaacaca
gatatgggattagaattggataacttagccaggttttttcatatggctgtagattacgcc
aagaagattgggtttacaggacagctcctgatagaaccaaaacccaaagagccgacaaag
caccaatatgactttgatgtcgcgtcagttttggcgtttctgcgcaagtatggcttagaa
aaggactttaaggtgaatattgaagcaaaccatgcaacgttagcggggcatactttccaa
catgagctgcattatgctcgtattaacggaagtttaggcagtgtcgatgctaatcaaggt
gacgaactgttgggctgggatacagatcagtttcccacgaacctttacacaacaacgttg
gctatgtatgaaatcctaaaaaatggcgggctgcacaagggtggactaaatttcgatgca
aaagtcagaagagcttcatttaccgctgaaaatatattccaagcgcatatcgctgggatg
gacgcctttgcccttggcttaaaagctgcctataagcttctcaagaacagagcattggaa
aacgttatcgaagaaaggtattgcagttacacctatgggattggtcaaaagatctgtgaa
ggcagaattggtttttcggaattagaagagtatgccttagcaaactcagttaagaaccaa
tctggatgccaagaagttctggaatcaattctcaatcgttatattattcaagctcaaaac
taa

DBGET integrated database retrieval system