KEGG   Desulfosporosinus acidiphilus: Desaci_1880Help
Entry
Desaci_1880       CDS       T02148                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desaci_1880
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desaci_1880
Enzymes [BR:dai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Desaci_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1943190..1944092
Genome map
AA seq 300 aa AA seqDB search
MNGRVIRIIGVPIDLGADRRGVDMGPSAMRYAGLNAELLRLGWKVEDLGNLEVPIPETRE
INNKLLKYLEEIAKVNEQLHLKVAEVIKEGGVPLILGGDHSLGIGSLAGLALSGRRFGLI
WFDTHGDYNSSVTTNSGNIHGMPLAVANGIGAKELTSIGGEQKKIREENTVIIGARDMDP
EEREMLRRSKITVFTMNDIDQRGMKEVVHEAIRRASLETDGIHVSFDLDVIDPLEAPGVG
TPVAGGITYREAHLAMELIAETGLLISMDMVEVNPILDYKNKTAELAVGLICSAFGKRIY
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggacgggtcattcgaattatcggggtgcccattgatcttggagcagatcggcgt
ggagtagatatggggccaagtgctatgcgctatgccgggttgaacgcagagttgctgcgg
ctgggatggaaggtcgaggatcttggcaatttggaggttccgattcctgagacacgtgaa
attaataataaactgctaaagtatttagaggaaattgccaaggttaacgagcagcttcat
ctcaaagttgccgaggtaatcaaagaggggggagttcctttgatcctcggcggtgatcat
agtttagggatcggttctttagcaggactggccttaagtggccggcggtttggcttgatt
tggtttgatactcacggagattataactcctctgtaacgacgaacagcggtaatattcac
ggaatgcctctggccgtagctaatggcatcggggcgaaagagttaacttcgattgggggg
gagcagaagaaaatacgagaagaaaatacagtaatcattggcgcacgagatatggaccct
gaagagcgggaaatgctgcgtcgctctaagattaccgtcttcacgatgaacgatatagac
cagcgaggaatgaaagaggttgtccatgaagcaattcgcagggcgtctctggaaacagat
ggaatccatgtgagttttgatttggatgttattgaccccttagaagcaccaggtgtaggg
acacctgttgccggaggaataacttatcgtgaagcacatttagcaatggaattgattgct
gaaaccggcctgcttataagcatggatatggtggaagtaaatcctattttagattataag
aacaagacggcagagttagcggttgggttaatttgttctgcgtttggaaaacgtatttat
tag

DBGET integrated database retrieval system