KEGG   Desulfosporosinus acidiphilus: Desaci_1890Help
Entry
Desaci_1890       CDS       T02148                                 

Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desaci_1890
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desaci_1890
   00640 Propanoate metabolism
    Desaci_1890
   00660 C5-Branched dibasic acid metabolism
    Desaci_1890
Enzymes [BR:dai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desaci_1890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1956628..1957764
Genome map
AA seq 378 aa AA seqDB search
MKLYEFMAKKILQNNGIPVPKGEIFTGVEGVAAFVEKTGPVAVKSQVLSGGRGKAGGIKF
ATAPQDALSLVQDLLAAEIKGSKVEKVLIEKKVSIEREIYLALTVDGAKKQPVLLASAAG
GMEVEQVPEELMIKRLIDVTIGLRPYAAREIARQMGLKGREAQQVSDLMLKLYQIFRKYD
AELVEINPLVVTPTQVLAADAKMTLDDDAAFRFLPEVPWVEERTAVEKKAGDLGISYVEL
DGDIGVMANGAGITMATLDLLKHFGAGARNFMDAGGGSSLEATAAALEILLSTNPKALLI
NIFGGITRCDEVAQAFVQVKNSLGLKLPVVIRLIGTNEDLGTAILQEQGIESFKNIEDAV
RKVIALLNGGGDDVHYYQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactttacgagtttatggccaaaaagattcttcaaaacaatgggatacctgtgcca
aagggtgaaatttttaccggagttgaaggcgtggccgcctttgttgaaaaaacgggtcct
gtggctgtcaaatctcaagttctttccgggggacgaggaaaggctggcggcataaagttc
gccacagctcctcaagacgccctttccctggtacaggatttgttggcggcggagattaag
ggcagcaaagtggagaaggttctcattgaaaaaaaggtgagtattgaacgcgaaatctac
cttgcccttacagttgatggcgctaaaaaacaaccggttctgttagcttctgcggccggt
gggatggaggttgagcaagtaccggaagaactgatgatcaagcgtcttattgacgttacc
attggccttcggccctatgccgcccgggaaatcgctcggcaaatgggattaaagggcagg
gaggctcaacaagtttccgatcttatgcttaagctctaccagattttccgcaagtacgat
gccgaattagtggaaattaacccgctggttgttactccaacgcaagttcttgccgctgat
gccaaaatgaccttggatgatgatgcagccttccgttttcttcctgaggttccctgggtt
gaagaaaggacagccgttgaaaagaaagccggagatttaggaatctcctatgttgagctg
gacggggatatcggagttatggctaacggggcaggaattacgatggctactcttgatctg
cttaaacattttggggccggtgcccgtaattttatggatgccggaggaggatcaagttta
gaagcgacggcagcagccttggaaatcttgctttctacaaaccctaaagcgctcttgatc
aatatcttcggcgggataactcgctgtgatgaggtagcacaggccttcgtacaagtaaag
aatagtcttggcctgaaactgcctgtcgttattcgcctcataggtaccaatgaagattta
ggaactgcaattttacaagaacagggcattgaatcatttaagaatattgaagacgctgta
agaaaagtaatcgctttactgaatgggggcggagacgatgtccattattatcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system