KEGG   Desulfosporosinus acidiphilus: Desaci_1934Help
Entry
Desaci_1934       CDS       T02148                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desaci_1934
Enzymes [BR:dai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Desaci_1934
Exosome [BR:dai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desaci_1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2003796..2004770
Genome map
AA seq 324 aa AA seqDB search
MDLKRRPRRLRSSETIRRMVRENHLRIDDLIYPMFVMPGENERVEVSSMPGVYNYSLDEF
VKALNEVVKLGIPAILLFGIPESKDSVGTGAYDEHGIVQEAVRIAKKHYPELYVITDVCL
CEYTDHGHCGVIDHGQILNDPTLDLLAQTALSHARAGADMVAPSDMMDGRVAAIRDLLDR
EGFTHIPIMAYSAKFASGFYGPFREAAGSAPQFGDRRTYQMDPPNGNEAMLETALDIEEG
ADMIIVKPALAYGDIICRTKDRFGLPIAAYNVSGEYAMVKAAAANGWIDEKRIVMEALVS
MKRAGADLVITYHALDAARWLREG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaaaagacgcccgcgacggctacggtctagcgagacaatccgcagaatggtt
cgagaaaaccatctgcgcatcgatgatttgatttatcctatgtttgtcatgcctggcgag
aatgagagagtggaagtctcttcaatgccaggagtatataactattctctggatgaattt
gtaaaggctttgaacgaagtggtaaaattagggatacccgcaattttactgttcggtatc
cctgagagtaaagacagtgtcggcacaggggcctatgatgaacacggtattgtccaagaa
gctgtgcgtatcgcgaaaaaacattatcctgagctttatgttataacggatgtttgtctt
tgtgagtataccgaccacggacattgcggagttattgatcacggacagattttgaacgat
ccgaccttagaccttttagctcagacagccctttcccatgcccgcgcaggtgcggatatg
gttgccccttctgatatgatggacggaagagttgcagccattcgggatttgttggatcgg
gaagggtttactcatattcccatcatggcttactcagctaaatttgcttcagggttttat
ggcccctttcgtgaggccgccggttcggcacctcagtttggggaccgcaggacctatcaa
atggacccgcctaacgggaacgaagcaatgctggagacagctttagatattgaagagggt
gcggatatgattatcgttaagccggctttagcctatggcgatattatctgccgcaccaaa
gatagatttggcttgcccattgccgcgtataatgtcagcggggagtatgccatggttaaa
gctgctgctgccaacggctggatcgatgagaaacgtatcgtcatggaagccttagtcagc
atgaaacgcgcgggagccgatttggtaattacctatcatgctctcgatgcagcacgttgg
ttaagagagggttaa

DBGET integrated database retrieval system