KEGG   Desulfosporosinus acidiphilus: Desaci_2048Help
Entry
Desaci_2048       CDS       T02148                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
dai00260  Glycine, serine and threonine metabolism
dai00750  Vitamin B6 metabolism
dai01100  Metabolic pathways
dai01110  Biosynthesis of secondary metabolites
dai01120  Microbial metabolism in diverse environments
dai01230  Biosynthesis of amino acids
Module
dai_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desaci_2048
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desaci_2048
Enzymes [BR:dai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desaci_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DZR Prok-RING_1 zf-ribbon_3 HypA zf-HIT zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AFM41022
UniProt: I4D5E8
Position
2115010..2116239
Genome map
AA seq 409 aa AA seqDB search
MENVLGLRCIQCGKELAAEPGVYTCPTCGSKAGIMDVIYDYSAINRQTTREKLSQSKDYS
IFRYLPFLPIRSETPRPHLRVGWSPLYKPPGLGKHLGMSNLYIKDDGQNPTASLKDRASI
IAVVKAVEENAATVACSSTGNAASSLAGSAAAMGLKSVIFVPSRAPQGKVAQLLIFGAKV
ISVHGSYEDTFMLSAEAIKRFGWYNRNAAINPYLVEGKKTVALEIAEQFQWDVPDWVVLS
VGDGCTIAGVWKGFKDLYQAGWIERLPKIVGVQSTGCCPLVDAFLENRPWKPAEENTLAD
SIAVGVPRNPDKALRAVRESGGTMIAVPDEEILEAMRELGRTSGIFGEPAGVTGMAGLKA
LVKRGVIGADDKVVAIVTGNGLKDVKNAIAAVGEPIKVEPSIEELMGKL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgtgttgggattgcgctgtattcagtgcggtaaggaactggcggctgaaccg
ggagtttatacctgcccgacctgcggttcgaaggcaggaattatggatgttatctatgat
tattcagctataaaccggcaaacaacccgggaaaaattatctcaatctaaagattactca
atctttcgctatttgccctttcttcccattcgctcggaaactccccggccccatctgagg
gtgggctggagccctttgtataagcctcccggtctaggcaagcatttagggatgagcaac
ctgtatatcaaagatgatgggcagaatccgacagcgtcattaaaggaccgggcttccatt
atagctgttgtcaaggcagtggaggaaaacgcagccaccgtggcttgttcttccacgggg
aatgccgcttcatccttagccggaagtgccgcggccatgggcttgaaaagtgtaattttt
gtacccagccgcgctccccaggggaaagtggctcaattgttgatctttggggcaaaggta
attagtgttcatggttcttatgaggataccttcatgctgtccgccgaagctatcaagcgt
tttggttggtataaccgcaatgcggccataaacccttatctggtggaaggtaaaaaaacg
gtagccctggaaatcgccgagcagtttcagtgggatgtcccggattgggttgtgctttcc
gtcggtgatggatgcaccattgccggggtatggaagggcttcaaagatttataccaagcc
ggatggattgaacgtttgcccaagatcgtcggggttcaatcgacaggatgctgccctctc
gttgatgccttcctggaaaaccgtccctggaagccggcggaagagaacaccttagctgac
agtattgctgttggtgtgcctcgaaacccggataaagcgttgcgggcggtgcgggaatca
ggaggaactatgattgccgtacctgacgaggaaatcctggaagctatgcgtgaactgggc
aggaccagcgggattttcggtgaaccggcaggggtaacgggaatggcaggacttaaagct
ctggttaaacggggggtcattggagccgacgataaggtcgtagcaatcgtcacgggaaat
ggcttaaaagatgtgaaaaacgctattgcggcagtgggtgaacctataaaagtggagcct
tctatcgaagaacttatggggaaactatag

DBGET integrated database retrieval system