KEGG   Desulfosporosinus acidiphilus: Desaci_2048Help
Entry
Desaci_2048       CDS       T02148                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desaci_2048
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desaci_2048
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desaci_2048
Enzymes [BR:dai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desaci_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2115010..2116239
Genome map
AA seq 409 aa AA seqDB search
MENVLGLRCIQCGKELAAEPGVYTCPTCGSKAGIMDVIYDYSAINRQTTREKLSQSKDYS
IFRYLPFLPIRSETPRPHLRVGWSPLYKPPGLGKHLGMSNLYIKDDGQNPTASLKDRASI
IAVVKAVEENAATVACSSTGNAASSLAGSAAAMGLKSVIFVPSRAPQGKVAQLLIFGAKV
ISVHGSYEDTFMLSAEAIKRFGWYNRNAAINPYLVEGKKTVALEIAEQFQWDVPDWVVLS
VGDGCTIAGVWKGFKDLYQAGWIERLPKIVGVQSTGCCPLVDAFLENRPWKPAEENTLAD
SIAVGVPRNPDKALRAVRESGGTMIAVPDEEILEAMRELGRTSGIFGEPAGVTGMAGLKA
LVKRGVIGADDKVVAIVTGNGLKDVKNAIAAVGEPIKVEPSIEELMGKL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgtgttgggattgcgctgtattcagtgcggtaaggaactggcggctgaaccg
ggagtttatacctgcccgacctgcggttcgaaggcaggaattatggatgttatctatgat
tattcagctataaaccggcaaacaacccgggaaaaattatctcaatctaaagattactca
atctttcgctatttgccctttcttcccattcgctcggaaactccccggccccatctgagg
gtgggctggagccctttgtataagcctcccggtctaggcaagcatttagggatgagcaac
ctgtatatcaaagatgatgggcagaatccgacagcgtcattaaaggaccgggcttccatt
atagctgttgtcaaggcagtggaggaaaacgcagccaccgtggcttgttcttccacgggg
aatgccgcttcatccttagccggaagtgccgcggccatgggcttgaaaagtgtaattttt
gtacccagccgcgctccccaggggaaagtggctcaattgttgatctttggggcaaaggta
attagtgttcatggttcttatgaggataccttcatgctgtccgccgaagctatcaagcgt
tttggttggtataaccgcaatgcggccataaacccttatctggtggaaggtaaaaaaacg
gtagccctggaaatcgccgagcagtttcagtgggatgtcccggattgggttgtgctttcc
gtcggtgatggatgcaccattgccggggtatggaagggcttcaaagatttataccaagcc
ggatggattgaacgtttgcccaagatcgtcggggttcaatcgacaggatgctgccctctc
gttgatgccttcctggaaaaccgtccctggaagccggcggaagagaacaccttagctgac
agtattgctgttggtgtgcctcgaaacccggataaagcgttgcgggcggtgcgggaatca
ggaggaactatgattgccgtacctgacgaggaaatcctggaagctatgcgtgaactgggc
aggaccagcgggattttcggtgaaccggcaggggtaacgggaatggcaggacttaaagct
ctggttaaacggggggtcattggagccgacgataaggtcgtagcaatcgtcacgggaaat
ggcttaaaagatgtgaaaaacgctattgcggcagtgggtgaacctataaaagtggagcct
tctatcgaagaacttatggggaaactatag

DBGET integrated database retrieval system