KEGG   Desulfosporosinus acidiphilus: Desaci_2165Help
Entry
Desaci_2165       CDS       T02148                                 

Definition
dipeptidase, putative
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dai  Desulfosporosinus acidiphilus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desaci_2165
  Amino acid metabolism
   00300 Lysine biosynthesis
    Desaci_2165
Enzymes [BR:dai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Desaci_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2230757..2232148
Genome map
AA seq 463 aa AA seqDB search
MELNQQIEQYKNDLIQSVQELIRIKSVQGEAQEGKPFGADVDEALNKALSIAEKMGFRTV
NLDGYIGYAEYGEGEDYVGVLGHLDVVPEGDGWIYPPYAAEIHDGKIYGRGTMDDKAPIL
AALYGLKAIKDLQLHLKRKVRVIFGTNEESGCQEMEHYLAREKPPVSGFTPDAEYPIIYA
EKGITFFDLVKNLEQKHEEDVVIKSMKGGQRANMVPDYCEAQVVAKDSAQIIKTVQEFAE
ITGYTIFAEPQDSGVIIKSKGVSAHGSLPHLGKNAIMQMMQLLGKLSLGDNDAANFIAFL
NKYVGMETDGKSFGVDLEDKESGKLSFNVGTISLENNEVRLGLNLRYPVTYNLEDMMDLI
YKRLEGTGIGVELNLHQKPLYFSVDHPLIKSLQKVYTEQTGMEATLLAIGGGTYAKEMPN
IVAFGPILPGEEDLDHQANEYIKIEHLVLNAKIYAHAIHELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaccaacaaatagagcaatataaaaatgacctgattcaatcggttcaggaa
cttattcgaattaaaagcgtccagggagaggcacaggaaggtaaacccttcggtgctgat
gtcgatgaggctctcaataaggctttgtcaattgcagaaaaaatgggatttagaaccgtt
aatttggatggctatattggttatgccgagtacggggaaggggaggactatgtgggtgtc
ctcgggcatctagatgtggttccagaaggtgatggctggatttatcctccttatgctgcc
gagattcatgacgggaaaatttatggccgaggaactatggatgataaagcgccgattcta
gctgctttatacggccttaaagccatcaaggatcttcagcttcacttgaaacgcaaggtt
agagtcatatttggcacaaatgaagagagcggctgccaggaaatggagcattatctggct
agggaaaaaccaccggtttccggttttactcctgatgctgaatatccgattatctatgct
gaaaaagggattaccttttttgacttggtaaaaaatctggagcaaaagcacgaggaagac
gttgtaatcaagtcgatgaagggcggacaaagagcaaatatggtgcctgattactgtgag
gcacaagttgtggcgaaggattcggctcaaatcattaagactgtccaagaatttgcagaa
atcactggttatactatttttgctgagccacaagatagtggagtgataattaagtcaaag
ggtgtttcagcccatggcagtctgcctcatctgggcaaaaatgccatcatgcagatgatg
caattgcttggtaaactgtcattgggcgacaatgatgcagctaactttatcgccttcttg
aataagtatgtcggcatggaaacagacgggaaatcctttggggttgatcttgaggacaag
gagtcagggaagctgtcttttaatgttgggacaatttccttagagaataacgaagtacgt
ttgggtttgaatttgcgctaccctgtaacctataacttagaggatatgatggatttaatc
tataaacgccttgaggggacaggtatcggagttgaacttaaccttcatcaaaaaccttta
tatttctcagtagatcatcccctaattaaatctttgcaaaaagtttatacggaacaaacc
ggcatggaagctactttattagccatcggcggcggaacatatgccaaagaaatgcctaac
attgtcgcttttgggccaatactgcctggtgaggaggatcttgatcaccaagctaatgaa
tacattaaaatagaacatttagtgctaaatgccaagatctatgctcatgcaatccacgaa
ttagcgaagtaa

DBGET integrated database retrieval system